y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g39700.1
FamilyGT1
Protein PropertiesLength: 466 Molecular Weight: 52643.3 Isoelectric Point: 5.992
ChromosomeChromosome/Scaffold: 02 Start: 44924127 End: 44926632
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12364364.1e-37
  SIPIYTVGPVIPYFGNGHIDFSNFADHELGYFQWLENQPSGSVLYISQGSFLSVSNEQIDEIAAGVRESGVRFLWVQRGENDRLKDICGDKGLVLQWCDQ
  LRVLQHHAIGGFWSHCGWNSTREGVFSGVPFLTFPIFMDQPLNGKLIVEEWKVGWRVRTKVKEDTLITKDEIASLIRKFMHLGSDEVRDMRKRSRELKQL
  C
Full Sequence
Protein Sequence     Length: 466     Download
MDDCIQVLPI TASHVVAVPY PGRGHVNPMM NLCKLLLSKN SDILVSFVVT EEWLGFIGSE    60
PKPDNIGFAT IPNVIPSEHG RASDFVGFFE SVMTKMEAPF EELLHRLQPL PTLIIYDTYL    120
FWVVRVANSR NIPVASFWPM SASVFAVFKH YHLLQQNGHY PVNVSEDGEK RVDYIPGNSS    180
IRLADFPLND ENWRSRKLLE LALNVIPWVQ KAQYLLFPSI YELEPQAIDA LKSELSIPIY    240
TVGPVIPYFG NGHIDFSNFA DHELGYFQWL ENQPSGSVLY ISQGSFLSVS NEQIDEIAAG    300
VRESGVRFLW VQRGENDRLK DICGDKGLVL QWCDQLRVLQ HHAIGGFWSH CGWNSTREGV    360
FSGVPFLTFP IFMDQPLNGK LIVEEWKVGW RVRTKVKEDT LITKDEIASL IRKFMHLGSD    420
EVRDMRKRSR ELKQLCHGAI ASGGSSETNI NDFLSHVLQG AKPEL*                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02554PLN025541.0e-5015457486+
PLN02210PLN022101.0e-5213457464+
PLN02173PLN021731.0e-5814457471+
PLN02555PLN025555.0e-6314457482+
PLN02448PLN0244809460453+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI15888.10184591440unnamed protein product [Vitis vinifera]
EMBLCBI15889.10214594440unnamed protein product [Vitis vinifera]
RefSeqXP_002274420.10184591441PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002274566.10184621450PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002278049.10124596451PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A01445810478A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A4.2039e-45144518461A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A4.2039e-45144518461A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A4.2039e-45144518461A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acw_B4.00001e-411345710461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4737EC-2.4.1dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FS322498224142320
FS319223224142320
DY29405832563210
DY26308831663130
HS1041402002654640
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00224.2Aquca_030_00224.1Aquca_030_00223.1Aquca_030_00247.1
Arabidopsis lyrata481926481925
Arabidopsis thalianaAT2G30150.1AT2G30140.1AT2G30140.2
Brachypodium distachyonBradi2g21317.1Bradi2g52740.1Bradi2g52750.1
Brassica rapaBra018333Bra022781Bra018334
Carica papayaevm.model.supercontig_46.189evm.model.supercontig_2.368
Capsella rubellaCarubv10023179mCarubv10023176m
Citrus clementinaCiclev10028376mCiclev10028375mCiclev10028356mCiclev10029825m
Citrus sinensisorange1.1g012096morange1.1g044218m
Cucumis sativusCucsa.139460.1Cucsa.139470.1
Eucalyptus grandisEucgr.B00404.1Eucgr.B00406.1Eucgr.J01864.1Eucgr.J01863.1Eucgr.J01875.1
Eucgr.B03993.1Eucgr.B03996.1Eucgr.J01877.1Eucgr.J01867.1Eucgr.B03994.1
Eucgr.B03997.2Eucgr.B03997.1Eucgr.J01880.1Eucgr.J01869.1Eucgr.B00411.1
Eucgr.J01874.1Eucgr.J01870.1Eucgr.B00409.1Eucgr.J01868.1Eucgr.J01873.1
Fragaria vescamrna28195.1-v1.0-hybridmrna28196.1-v1.0-hybridmrna28194.1-v1.0-hybridmrna28201.1-v1.0-hybridmrna28199.1-v1.0-hybrid
mrna28200.1-v1.0-hybridmrna28193.1-v1.0-hybrid
Glycine maxGlyma02g39680.1Glyma02g39700.2Glyma14g37770.1Glyma14g37730.1Glyma04g36200.1
Glyma04g36200.2Glyma11g29480.2
Gossypium raimondiiGorai.013G271000.1Gorai.009G113100.1Gorai.009G113100.2Gorai.013G270900.1Gorai.013G271100.1
Linum usitatissimumLus10042260Lus10026394Lus10026393Lus10042261Lus10042262
Lus10042264
Malus domesticaMDP0000593031MDP0000376869MDP0000173539MDP0000222559MDP0000686301
MDP0000396630MDP0000396403MDP0000739392.384.594MDP0000739392.384.594MDP0000263453
MDP0000317841MDP0000276057MDP0000379060MDP0000902216MDP0000156246
MDP0000313145MDP0000166802MDP0000229763MDP0000811246
Manihot esculentacassava4.1_007402mcassava4.1_007201m
Medicago truncatulaMedtr5g072810.1Medtr5g072830.1Medtr5g072820.1Medtr5g072840.1Medtr5g072860.1
Medtr3g031400.1Medtr3g031450.1Medtr5g075440.1Medtr5g072850.1
Mimulus guttatusmgv1a005987mmgv1a021616m
Oryza sativaLOC_Os01g59110.1LOC_Os01g59100.1LOC_Os05g41400.1
Panicum virgatumPavirv00005550mPavirv00033216mPavirv00018377mPavirv00053061m
Phaseolus vulgarisPhvul.008G256800.2Phvul.008G256800.1Phvul.008G256600.1Phvul.008G256600.2Phvul.008G257200.1
Picea abiesMA_10434904g0010
Populus trichocarpaPotri.001G281900.1Potri.001G282100.1Potri.009G077400.1Potri.009G077200.1Potri.009G077500.1
Potri.001G281800.1
Prunus persicappa015751mppa022795mppa024989mppa006015mppa019639m
ppa026425mppa005406m
Ricinus communis27561.m00029029628.m000755
Setaria italicaSi004951mSi024733mSi024959mSi001326m
Selaginella moellendorffii439509
Sorghum bicolorSb03g037450.1Sb03g037440.1Sb09g024190.1
Thellungiella halophilaThhalv10025222mThhalv10016641m
Vitis viniferaGSVIVT01024653001GSVIVT01024655001GSVIVT01024656001GSVIVT01024649001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)