y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma02g43020.2
FamilyGH85
Protein PropertiesLength: 681 Molecular Weight: 76339 Isoelectric Point: 6.2285
ChromosomeChromosome/Scaffold: 02 Start: 47900041 End: 47908728
DescriptionGlycosyl hydrolase family 85
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH85703540
  MAGGYLDDKWVQGGTNAEAYAIWHWHLIDVFVYFSHNLVTLPPPSWTNTAHRHGVKVLGTFITEGDEGAVVCDEMLSTKESAQMYATKDNTQLQLNMEVS
  LKPKQISNLKEFVNHLSLTTHSSVPGSLVIWYDSVTINGDLWWQDELNEHNKPFFDICDGIFTNYTWQEDYPRRSAAVAGDRKFDVYMGIDIFGRNTYGG
  GMWNCFPDVILCMCQTNAALDVIRKDDVSAAIFAPGWVYETKQAPDFETAQNRWWSLVGKSWGITRKYLGTLPFYTNFDQGSGYH
Full Sequence
Protein Sequence     Length: 681     Download
MSHSINSESE FDPKQPSVPI SYPIKTLKDL ESRSYYESFH YPFNKASVPI ESGHSAPLPN    60
RRRILVCHDM AGGYLDDKWV QGGTNAEAYA IWHWHLIDVF VYFSHNLVTL PPPSWTNTAH    120
RHGVKVLGTF ITEGDEGAVV CDEMLSTKES AQMYATKDNT QLQLNMEVSL KPKQISNLKE    180
FVNHLSLTTH SSVPGSLVIW YDSVTINGDL WWQDELNEHN KPFFDICDGI FTNYTWQEDY    240
PRRSAAVAGD RKFDVYMGID IFGRNTYGGG MWNCFPDVIL CMCQTNAALD VIRKDDVSAA    300
IFAPGWVYET KQAPDFETAQ NRWWSLVGKS WGITRKYLGT LPFYTNFDQG SGYHISVDGD    360
QVSDAPWCNI SSQGVQPLLE FADSTANSIQ LIVNLKEASY NGGGNITFKG SLEKDTYFKR    420
RIFQGEFILS KLPIHFFYSV KSDSNSSLGL VLEFTSTINK TMSVLLTSHG MDHLSSEFSK    480
VVLTSEHKGN ALGWVIHEGT IEMNGYILTG IHALCYKPNA PSKELKSRPF GPGHTAPSST    540
DYSAVLGHIT VKTSNYKPDF PISTSWLVDG EYIHWKSGPQ DSRILSVKIS WNLKGKNFAF    600
PHYNVFVEKP PKLADGNSGT TLEPVQEYLG VAHVNCFYVS ELKVPASTSS LKFIIQVCDF    660
DGTNRNLEDC PYYQLEIKGL *                                              720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4724COG47245.0e-3243501511+
pfam03644Glyco_hydro_856.0e-10970357315+
cd06547GH85_ENGase7.0e-11865382346+
Gene Ontology
GO TermDescription
GO:0005737cytoplasm
GO:0033925mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002273683.101167916689PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315137.101767926698predicted protein [Populus trichocarpa]
RefSeqXP_002315138.10267912695predicted protein [Populus trichocarpa]
RefSeqXP_002520781.101167919692endo beta n-acetylglucosaminidase, putative [Ricinus communis]
RefSeqXP_002520784.101167917686endo beta n-acetylglucosaminidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fhq_F1e-194245328465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_D1e-194245328465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_B1e-194245328465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_A1e-194245328465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_D2e-194245328465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV2685082424226620
BU5509112124706810
CX5485332344496810
CX5486932254586810
BF0667892004406390
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00225.1
Arabidopsis lyrata497439.76.201497439.76.201872478497439.204.302487338
497439.204.302
Arabidopsis thalianaAT5G05460.1AT3G11040.1
Brachypodium distachyonBradi1g14127.1
Brassica rapaBra034160Bra005854
Carica papayaevm.model.supercontig_19.130
Capsella rubellaCarubv10000369mCarubv10013078m
Chlamydomonas reinhardtiiCre13.g582250.t1.2
Citrus clementinaCiclev10031026m.70.259Ciclev10031026m.70.259Ciclev10030777m
Cucumis sativusCucsa.144380.1Cucsa.144370.1
Eucalyptus grandisEucgr.J00174.1
Fragaria vescamrna21040.1-v1.0-hybrid
Glycine maxGlyma14g06120.2Glyma18g40011.1Glyma02g43025.1Glyma11g35630.1Glyma14g06130.1
Glyma14g06120.1Glyma18g02770.1
Gossypium raimondiiGorai.012G079500.1Gorai.011G290600.1
Linum usitatissimumLus10017430Lus10007526
Manihot esculentacassava4.1_029708mcassava4.1_031267m
Medicago truncatulaMedtr3g071610.1
Mimulus guttatusmgv1a002327mmgv1a001722m
Oryza sativaLOC_Os05g27960.1
Physcomitrella patensPp1s13_33V6.2Pp1s13_33V6.1
Phaseolus vulgarisPhvul.001G245900.1
Picea abiesMA_10436931g0010MA_10435721g0010
Populus trichocarpaPotri.008G073000.1Potri.010G184300.1Potri.010G184300.2Potri.010G184200.1Potri.010G184200.2
Prunus persicappa015834m
Ricinus communis29729.m00228229729.m002279
Setaria italicaSi021368m
Selaginella moellendorffii61572
Sorghum bicolorSb09g016230.1
Thellungiella halophilaThhalv10012879mThhalv10020200m
Vitis viniferaGSVIVT01032751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny