y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g00633.1
FamilyGH51
Protein PropertiesLength: 622 Molecular Weight: 69121.6 Isoelectric Point: 5.7735
ChromosomeChromosome/Scaffold: 03 Start: 358214 End: 362077
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH511886170
  GFVWLDQVSAMPLDTYKGHGFRKDLFQMVADLKPKFFRFPGGCYVEGDYLRNAFRWKDTVGPWEERPGHYGDVWNYWSDDGFGFFEGLQLAEDLGALPVW
  VFNNGISHHDEVNTSAIAPFVHEALDGIEFARGSPESRWGSLRASMGHPKPFDLRIVAIGNEDCDKFNYKGNYLKFYDAIRRVYPDIQIISNCDGSENPL
  DHPADLYDFHIYTNAEDMFSKSTKFDNVSRYGPKAFVSEYAVWQDDAGNGTLLAAVAEAAFLIGLEKNSDIVSMVSYAPLFVNANDRKWTPDAIAFDSYR
  HYETPSYWVQCLFIPSSGATLLNSTLLSSSNKSLAASAIEYTNPANKKNYLRIKVVNFGDHTENLRIFVNGLDSKVQQSGSTKIVLTAPNVREENSFSEP
  KKIVPQHTSLEAASEDMNVILSPYSVTSFD
Full Sequence
Protein Sequence     Length: 622     Download
QTSTLIIDAI ATRKIPDTFL GAFFEEINHA GAGGLWAELV RNRGFEAGGS NVPSNIYPWS    60
IIGDDSTILV STDRTSSFER NKVALSMKVL CNESNPCPSG GVGISNPGYW GMNIEKGKKY    120
KVVFYAKADG AINLNVSFVG TEKGEKLASN NIRSYKHNVT NWTRMEVIIE AKATNHNASL    180
QITTSKSGFV WLDQVSAMPL DTYKGHGFRK DLFQMVADLK PKFFRFPGGC YVEGDYLRNA    240
FRWKDTVGPW EERPGHYGDV WNYWSDDGFG FFEGLQLAED LGALPVWVFN NGISHHDEVN    300
TSAIAPFVHE ALDGIEFARG SPESRWGSLR ASMGHPKPFD LRIVAIGNED CDKFNYKGNY    360
LKFYDAIRRV YPDIQIISNC DGSENPLDHP ADLYDFHIYT NAEDMFSKST KFDNVSRYGP    420
KAFVSEYAVW QDDAGNGTLL AAVAEAAFLI GLEKNSDIVS MVSYAPLFVN ANDRKWTPDA    480
IAFDSYRHYE TPSYWVQCLF IPSSGATLLN STLLSSSNKS LAASAIEYTN PANKKNYLRI    540
KVVNFGDHTE NLRIFVNGLD SKVQQSGSTK IVLTAPNVRE ENSFSEPKKI VPQHTSLEAA    600
SEDMNVILSP YSVTSFDLLI K*                                             660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam06964Alpha-L-AF_C3.0e-29425612206+
COG3534AbfA4.0e-35207613480+
smart00813Alpha-L-AF_C1.0e-36425612198+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP97437.10162132657alpha-L-arabinofuranosidase [Malus x domestica]
GenBankABV08815.10162122647alpha-L-arabinofuranosidase [Fragaria x ananassa]
GenBankABV32544.10162132660alpha-L-arabinofuranosidase protein [Prunus persica]
DDBJBAF42035.10162132657alpha-Arabinosidase1 [Pyrus communis]
RefSeqXP_002523672.10262139661Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2c_L2e-2020658747451A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_K2e-2020658747451A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_J2e-2020658747451A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_I2e-2020658747451A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_H2e-2020658747451A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8526834142076180
HO8072913161144290
HO7807403862356190
GT0462043091925000
JG577027334633960
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2Glyma19g30145.1
Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)