y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g08040.1
FamilyGH9
Protein PropertiesLength: 151 Molecular Weight: 16698.2 Isoelectric Point: 8.4376
ChromosomeChromosome/Scaffold: 03 Start: 8879133 End: 8879731
Descriptionglycosyl hydrolase 9B7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9351511.9e-29
  YCSALKTAMQFFDAFILFPLKYAGRLVDSKISWRGNSALKDGSQAKLDLSKGMYDARDNMKFGFPMAFMATVLSWSILEYGDQMDHVGQLDAAQDSLKWI
  TDFLINAHPSENVLYIQ
Full Sequence
Protein Sequence     Length: 151     Download
PVAAIVFTVK KKFSHSGSDK PAPVLGPPGA VDQKYCSALK TAMQFFDAFI LFPLKYAGRL    60
VDSKISWRGN SALKDGSQAK LDLSKGMYDA RDNMKFGFPM AFMATVLSWS ILEYGDQMDH    120
VGQLDAAQDS LKWITDFLIN AHPSENVLYI Q                                   180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02613PLN026133.0e-3029151124+
PLN02171PLN021711.0e-3422149129+
PLN00119PLN001192.0e-3529151124+
pfam00759Glyco_hydro_93.0e-3735151118+
PLN02345PLN023455.0e-6438151114+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF42037.101515138167cellulase2 [Pyrus communis]
RefSeqXP_002276739.101815138165PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300715.101815138166predicted protein [Populus trichocarpa]
RefSeqXP_002307711.103115151165predicted protein [Populus trichocarpa]
RefSeqXP_002510516.101115133165endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4tf4_B4e-28341515117B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB4tf4_A4e-28341515117B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB3tf4_B4e-28341515117B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB3tf4_A4e-28341515117B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB1tf4_B4e-28341515117B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO03686915021510
GR84216015111510
DB95835715021510
AW27780315021510
EG98400414921500
Orthologous Group
SpeciesID
Glycine maxGlyma06g28630.1
Malus domesticaMDP0000178787
Panicum virgatumPavirv00020322m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny