y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g08820.1
FamilyCBM20
Protein PropertiesLength: 211 Molecular Weight: 24010.3 Isoelectric Point: 4.5192
ChromosomeChromosome/Scaffold: 03 Start: 10002483 End: 10004647
DescriptionCarbohydrate-binding-like fold
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM20931783.3e-27
  VRVSFQLQKTCNFGEQFLIVGGDPVLGSWDPLEALPMTWSEGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLIHTWETK
Full Sequence
Protein Sequence     Length: 211     Download
MMKALTSSCS KATVETLGPF SPRVPRCVSD RPEFCFTLRS KNEKRGWNLL LLKLVRNNDL    60
YPVHAVPPKD QVDLETVEPQ AQQSEQTNES KFVRVSFQLQ KTCNFGEQFL IVGGDPVLGS    120
WDPLEALPMT WSEGHVWAVE LDMPAGQTFQ YKFILKGEGG DIIWQPGLDR LIHTWETKNR    180
IVVLEDWENV ELQKITEEDQ LAEPNEEPQV *                                   240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02853E_set_MTHase_like_N1.0e-159317482+
cd02856E_set_GDE_Isoamylase_N5.0e-189318799+
smart01065CBM_23.0e-189317688+
pfam00686CBM_201.0e-209317788+
cd05467CBM203.0e-269418797+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0005975carbohydrate metabolic process
GO:2001070starch binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU23169.1012101210unknown [Glycine max]
EMBLCAN60108.105521024175hypothetical protein [Vitis vinifera]
EMBLCBI30404.105521048199unnamed protein product [Vitis vinifera]
RefSeqXP_002308216.11.4013e-458421021147predicted protein [Populus trichocarpa]
RefSeqXP_002322974.1022101215predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1cyg_A0.0000000387189576680A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase)
PDB1kum_A0.000000193170788A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase)
PDB1kul_A0.000000193170788A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase)
PDB1acz_A0.000000193170788A Chain A, Glucoamylase, Granular Starch-Binding Domain Complex With Cyclodextrin, Nmr, 5 Structures
PDB1ac0_A0.000000193170788A Chain A, Glucoamylase, Granular Starch-Binding Domain Complex With Cyclodextrin, Nmr, Minimized Average Structure
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG99104021112110
FG98687421012100
FG98669821012100
EH26129618711870
EH261296241872100.003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00042.3Aquca_045_00042.2Aquca_045_00042.1Aquca_009_00054.3.18.103
Arabidopsis lyrata486949489476
Arabidopsis thalianaAT5G01260.2AT5G01260.1AT5G26570.2AT5G26570.1
Brachypodium distachyonBradi2g55380.3Bradi2g55380.2Bradi2g55380.1
Brassica rapaBra005693
Carica papayaevm.model.supercontig_112.34evm.model.supercontig_163.14
Capsella rubellaCarubv10001501mCarubv10001111mCarubv10000070m
Chlamydomonas reinhardtiiCre17.g719900.t1.2Cre17.g703000.t1.3Cre06.g269650.t1.2Cre12.g551200.t1.2g10103.t1
Cre02.g091750.t2.1Cre02.g091750.t1.2Cre02.g091750.t3.1Cre12.g492750.t1.3.499.578Cre12.g492750.t1.3.499.578
Cre09.g415600.t2.1Cre09.g415600.t1.3Cre12.g492750.t1.3.218.305Cre12.g492750.t1.3.218.305Cre10.g450500.t1.2
Citrus clementinaCiclev10011625mCiclev10011624mCiclev10011524mCiclev10011409mCiclev10005295m
Ciclev10005277mCiclev10004968mCiclev10010989m.24.109
Citrus sinensisorange1.1g012444morange1.1g012471morange1.1g015140morange1.1g002052m.24.109orange1.1g002050m.24.109
orange1.1g002027m.24.109
Cucumis sativusCucsa.176290.3Cucsa.176290.1
Eucalyptus grandisEucgr.K02988.2Eucgr.K02988.1Eucgr.K01679.1.16.104
Fragaria vescamrna18850.1-v1.0-hybrid
Glycine maxGlyma03g08980.1Glyma07g17931.1Glyma03g08930.1Glyma18g42781.1Glyma03g08910.2
Glyma1061s50.2Glyma1061s50.1Glyma03g08850.2Glyma03g08850.1Glyma0165s00200.1
Glyma01g28520.2Glyma01g28520.1Glyma03g08860.1Glyma03g08893.1Glyma19g30580.1.16.102
Glyma03g27600.1.16.103
Gossypium raimondiiGorai.006G181700.3Gorai.006G181700.2Gorai.006G181700.1Gorai.007G379100.3Gorai.007G379100.2
Gorai.007G379100.1Gorai.011G147600.3Gorai.011G147600.2Gorai.011G147600.1Gorai.010G128900.7.16.102
Gorai.010G128900.6.16.102
Linum usitatissimumLus10004826Lus10002495Lus10027767Lus10035528Lus10018226
Lus10041275Lus10031010.16.103Lus10035408.16.103
Malus domesticaMDP0000179937MDP0000520902MDP0000218204MDP0000256086MDP0000293128
MDP0000162900MDP0000149290.20.108
Manihot esculentacassava4.1_014927mcassava4.1_029798mcassava4.1_001086m.16.100
Medicago truncatulaMedtr4g015550.1Medtr7g088740.1.16.104
Mimulus guttatusmgv1a007499mmgv1a000923m.17.105
Oryza sativaLOC_Os01g63810.2LOC_Os01g63810.1LOC_Os05g37450.1LOC_Os07g46790.1.13.101
Panicum virgatumPavirv00009276mPavirv00009275mPavirv00011172mPavirv00049022mPavirv00069370m.17.104
Pavirv00069369m.17.104Pavirv00069371m.17.105
Physcomitrella patensPp1s127_37V6.1Pp1s103_94V6.2Pp1s103_94V6.1Pp1s49_209V6.2Pp1s49_209V6.1
Phaseolus vulgarisPhvul.010G002900.1Phvul.008G105500.1Phvul.001G117500.1
Picea abiesMA_10436655g0010
Populus trichocarpaPotri.009G044800.2Potri.009G044800.1Potri.016G114500.7Potri.016G114500.4Potri.016G114500.3
Potri.016G114500.2Potri.016G114500.1Potri.006G099200.3Potri.006G099200.2Potri.006G099200.1
Prunus persicappa007150mppa020714mppa000429mppa000782m.16.104
Ricinus communis29681.m00133229701.m00061530045.m000475.16.104
Setaria italicaSi002103mSi022447mSi028900m.11.98Si028839m.11.98Si034110m.17.104
Selaginella moellendorffii438530415024440606
Sorghum bicolorSb03g040350.1Sb09g021950.1Sb02g042100.1.13.100
Thellungiella halophilaThhalv10014134mThhalv10013736mThhalv10003634m
Vitis viniferaGSVIVT01033976001GSVIVT01025810001.16.103
Volvox carteriVocar20005575mVocar20005574mVocar20000733mVocar20001112mVocar20009467m
Vocar20004703m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)