y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g08850.2
FamilyCBM20
Protein PropertiesLength: 276 Molecular Weight: 31658.9 Isoelectric Point: 4.2889
ChromosomeChromosome/Scaffold: 03 Start: 10061267 End: 10068927
DescriptionCarbohydrate-binding-like fold
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM20931785.6e-27
  VRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWSEGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLIHTWETK
Full Sequence
Protein Sequence     Length: 276     Download
MMKALTSSCS KAMVETLGPF SPRVPLCVSD RPEFCFTLRS KSEKKGWNLL LLKLVRNNDL    60
YPVHAVPPKD QVDLETVEPQ AQQSEQTNES KFVRVSFQLQ KTCNFGEQFL IVGGGPVLGS    120
WDPLEALPMT WSEGHVWAVE LDMPAGQTFQ YKFILKGEGG DIIWQPGLDR LIHTWETKNR    180
IVVLEDWENV ELQKITEEDQ LAEPNEEPQE FIQFEDQDMS QVGKSQLDTY LEEANLSNKY    240
HPNLDVLQYW KDNQAQFPDF VTPPMMVGWS IFEWT*                              300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02853E_set_MTHase_like_N3.0e-159317482+
cd02856E_set_GDE_Isoamylase_N9.0e-189318799+
smart01065CBM_23.0e-189317688+
pfam00686CBM_201.0e-199317788+
cd05467CBM202.0e-259418797+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0005975carbohydrate metabolic process
GO:2001070starch binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU23169.1012151213unknown [Glycine max]
EMBLCAN60108.11.4013e-455520824173hypothetical protein [Vitis vinifera]
EMBLCBI30404.11.4013e-455520848197unnamed protein product [Vitis vinifera]
RefSeqXP_002308216.12.00386e-438720824145predicted protein [Populus trichocarpa]
RefSeqXP_002322974.1022081213predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1cyg_A0.00000044189487680A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase)
PDB1kum_A0.000000493170788A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase)
PDB1kul_A0.000000493170788A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase)
PDB1acz_A0.000000493170788A Chain A, Glucoamylase, Granular Starch-Binding Domain Complex With Cyclodextrin, Nmr, 5 Structures
PDB1ac0_A0.000000493170788A Chain A, Glucoamylase, Granular Starch-Binding Domain Complex With Cyclodextrin, Nmr, Minimized Average Structure
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG99104020912090
FG98687420912090
FG98669820912090
EH26129618811880
EH261296231872090.02
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00042.3Aquca_045_00042.2Aquca_045_00042.1Aquca_009_00054.3.18.103
Arabidopsis lyrata486949489476
Arabidopsis thalianaAT5G01260.2AT5G01260.1AT5G26570.2AT5G26570.1
Brachypodium distachyonBradi2g55380.3Bradi2g55380.2Bradi2g55380.1
Brassica rapaBra005693
Carica papayaevm.model.supercontig_112.34evm.model.supercontig_163.14
Capsella rubellaCarubv10001501mCarubv10001111mCarubv10000070m
Chlamydomonas reinhardtiiCre17.g719900.t1.2Cre17.g703000.t1.3Cre06.g269650.t1.2Cre12.g551200.t1.2g10103.t1
Cre02.g091750.t2.1Cre02.g091750.t1.2Cre02.g091750.t3.1Cre12.g492750.t1.3.499.578Cre12.g492750.t1.3.499.578
Cre09.g415600.t2.1Cre09.g415600.t1.3Cre12.g492750.t1.3.218.305Cre12.g492750.t1.3.218.305Cre10.g450500.t1.2
Citrus clementinaCiclev10011625mCiclev10011624mCiclev10011524mCiclev10011409mCiclev10005295m
Ciclev10005277mCiclev10004968mCiclev10010989m.24.109
Citrus sinensisorange1.1g012444morange1.1g012471morange1.1g015140morange1.1g002052m.24.109orange1.1g002050m.24.109
orange1.1g002027m.24.109
Cucumis sativusCucsa.176290.3Cucsa.176290.1
Eucalyptus grandisEucgr.K02988.2Eucgr.K02988.1Eucgr.K01679.1.16.104
Fragaria vescamrna18850.1-v1.0-hybrid
Glycine maxGlyma03g08980.1Glyma07g17931.1Glyma03g08820.1Glyma03g08930.1Glyma18g42781.1
Glyma03g08910.2Glyma1061s50.2Glyma1061s50.1Glyma03g08850.1Glyma0165s00200.1
Glyma01g28520.2Glyma01g28520.1Glyma03g08860.1Glyma03g08893.1Glyma19g30580.1.16.102
Glyma03g27600.1.16.103
Gossypium raimondiiGorai.006G181700.3Gorai.006G181700.2Gorai.006G181700.1Gorai.007G379100.3Gorai.007G379100.2
Gorai.007G379100.1Gorai.011G147600.3Gorai.011G147600.2Gorai.011G147600.1Gorai.010G128900.7.16.102
Gorai.010G128900.6.16.102
Linum usitatissimumLus10004826Lus10002495Lus10027767Lus10035528Lus10018226
Lus10041275Lus10031010.16.103Lus10035408.16.103
Malus domesticaMDP0000179937MDP0000520902MDP0000218204MDP0000256086MDP0000293128
MDP0000162900MDP0000149290.20.108
Manihot esculentacassava4.1_014927mcassava4.1_029798mcassava4.1_001086m.16.100
Medicago truncatulaMedtr4g015550.1Medtr7g088740.1.16.104
Mimulus guttatusmgv1a007499mmgv1a000923m.17.105
Oryza sativaLOC_Os01g63810.2LOC_Os01g63810.1LOC_Os05g37450.1LOC_Os07g46790.1.13.101
Panicum virgatumPavirv00009276mPavirv00009275mPavirv00011172mPavirv00049022mPavirv00069370m.17.104
Pavirv00069369m.17.104Pavirv00069371m.17.105
Physcomitrella patensPp1s127_37V6.1Pp1s103_94V6.2Pp1s103_94V6.1Pp1s49_209V6.2Pp1s49_209V6.1
Phaseolus vulgarisPhvul.010G002900.1Phvul.008G105500.1Phvul.001G117500.1
Picea abiesMA_10436655g0010
Populus trichocarpaPotri.009G044800.2Potri.009G044800.1Potri.016G114500.7Potri.016G114500.4Potri.016G114500.3
Potri.016G114500.2Potri.016G114500.1Potri.006G099200.3Potri.006G099200.2Potri.006G099200.1
Prunus persicappa007150mppa020714mppa000429mppa000782m.16.104
Ricinus communis29681.m00133229701.m00061530045.m000475.16.104
Setaria italicaSi002103mSi022447mSi028900m.11.98Si028839m.11.98Si034110m.17.104
Selaginella moellendorffii438530415024440606
Sorghum bicolorSb03g040350.1Sb09g021950.1Sb02g042100.1.13.100
Thellungiella halophilaThhalv10014134mThhalv10013736mThhalv10003634m
Vitis viniferaGSVIVT01033976001GSVIVT01025810001.16.103
Volvox carteriVocar20005575mVocar20005574mVocar20000733mVocar20001112mVocar20009467m
Vocar20004703m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)