y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g15805.1
FamilyAA1
Protein PropertiesLength: 572 Molecular Weight: 63410.1 Isoelectric Point: 7.0042
ChromosomeChromosome/Scaffold: 03 Start: 20045443 End: 20050636
Descriptionlaccase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1245580
  AVVEHIFNVENITVQRLCRQQVITAVNGTLPGPTINAREGDTVVVHVFNKSPYNLTIHWHGIFQFLTPWSDGPEFATQCPIASGSSYTYRFNLTGQEGTL
  WWHAHSSFLRATVYGALLIRPRLGHSYPFPKVYQEIPILVGEWWNANVVEVEQNATETQQPPIESDAYTINGLPSDLYNCSQDGTYQVKVKQGKTYLLRI
  INSALNNQHFFEVANHTLTVVAIDATYTNHYDTKVVVLAPGQTVDVLLRTNQSVGSYYMAFTPYHSAPLVQINANMTRGVIIYEGATSAKPIMPDLPAQT
  DTPTAHKFYTNITGLAGGPHWVPVPRQVDEHMFITFGLSFDICRSDTGVCPGPVPLFSANMNNESFVLPHGKGVSMLEAFFRNDVTGVYTRDFPDQPAVV
  FDFTNPNITSSPDTPREFLIAPKSTKVKTLKFNSTVQIVLQNTAIIAAENHPIHLHGFNFHVLAQGFGNYNATRDEPKFNFVNPQIRNTIAVPVGGWSVI
  RFQANNPGVWLMHCHLETHLPWGLSTAFEVENGPS
Full Sequence
Protein Sequence     Length: 572     Download
MKRFVFALAR AFALFLACSL ASGAVVEHIF NVENITVQRL CRQQVITAVN GTLPGPTINA    60
REGDTVVVHV FNKSPYNLTI HWHGIFQFLT PWSDGPEFAT QCPIASGSSY TYRFNLTGQE    120
GTLWWHAHSS FLRATVYGAL LIRPRLGHSY PFPKVYQEIP ILVGEWWNAN VVEVEQNATE    180
TQQPPIESDA YTINGLPSDL YNCSQDGTYQ VKVKQGKTYL LRIINSALNN QHFFEVANHT    240
LTVVAIDATY TNHYDTKVVV LAPGQTVDVL LRTNQSVGSY YMAFTPYHSA PLVQINANMT    300
RGVIIYEGAT SAKPIMPDLP AQTDTPTAHK FYTNITGLAG GPHWVPVPRQ VDEHMFITFG    360
LSFDICRSDT GVCPGPVPLF SANMNNESFV LPHGKGVSML EAFFRNDVTG VYTRDFPDQP    420
AVVFDFTNPN ITSSPDTPRE FLIAPKSTKV KTLKFNSTVQ IVLQNTAIIA AENHPIHLHG    480
FNFHVLAQGF GNYNATRDEP KFNFVNPQIR NTIAVPVGGW SVIRFQANNP GVWLMHCHLE    540
THLPWGLSTA FEVENGPSIR VPPPPADLPK C*                                  600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_36.0e-4831145117+
PLN02191PLN021912.0e-5925551560+
PLN02604PLN026042.0e-6941552560+
TIGR03388ascorbase5.0e-7725552574+
TIGR03389laccase028571548+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002276415.101957118565PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308196.1015711562laccase 110a [Populus trichocarpa]
RefSeqXP_002322939.101957118569predicted protein [Populus trichocarpa]
RefSeqXP_002333273.101957118568predicted protein [Populus trichocarpa]
RefSeqXP_002527888.10295711540laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B02655110521B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB1asq_A02655110521B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB1asp_B02655110521B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB1asp_A02655110521B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
PDB1aso_B02655110521B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR85695525512550
GR8337742413225620
GR8521652131403520
HO797675509705720
HO7610012631524110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00804.1Aquca_009_00807.1Aquca_009_00807.2
Arabidopsis lyrata478237472269486975
Arabidopsis thalianaAT3G09220.1AT5G01040.1AT5G01050.1
Brachypodium distachyonBradi4g39330.1Bradi2g55050.1Bradi2g55060.1Bradi4g11827.1Bradi4g11850.1
Bradi3g45190.1Bradi1g10567.1Bradi3g22317.1Bradi4g11780.1Bradi4g11770.1
Bradi4g11840.1Bradi3g02290.1Bradi3g02300.1
Brassica rapaBra029753Bra028885Bra005699
Capsella rubellaCarubv10016347mCarubv10000548m
Glycine maxGlyma01g26750.1Glyma03g15800.5Glyma01g26750.2Glyma07g17170.1Glyma18g41886.1
Glyma18g41860.1Glyma07g17150.1Glyma18g41870.1
Malus domesticaMDP0000291183
Manihot esculentacassava4.1_006971m
Oryza sativaLOC_Os01g63200.1LOC_Os01g63190.1LOC_Os11g42200.1LOC_Os11g42220.1LOC_Os11g16260.1
LOC_Os10g20610.1
Panicum virgatumPavirv00040765mPavirv00049024mPavirv00038281mPavirv00007769mPavirv00063349m
Pavirv00062920mPavirv00053056mPavirv00047982mPavirv00069158mPavirv00051794m
Pavirv00019186mPavirv00057102mPavirv00039741mPavirv00033330mPavirv00023383m
Pavirv00050058mPavirv00043455mPavirv00033589mPavirv00032842mPavirv00018047m
Pavirv00032841mPavirv00054602mPavirv00028624mPavirv00051105mPavirv00056353m
Pavirv00054858mPavirv00054859m
Phaseolus vulgarisPhvul.010G005900.1Phvul.008G112100.1
Setaria italicaSi021601mSi020688mSi027309mSi021573mSi021628m
Si004353mSi000613mSi026121mSi028303mSi027928m
Si009653mSi026113mSi028115mSi027394mSi026118m
Si026123mSi026150mSi026109mSi028248mSi027660m
Si026140mSi027267mSi026136mSi027586mSi026159m
Si026153mSi026117mSi028198mSi026161mSi026162m
Si008101mSi026299mSi026376mSi026137mSi024846m
Si001570mSi001277mSi001174mSi027990m.20.264Si027990m.20.264
Si027990m.273.533Si027990m.273.533
Sorghum bicolorSb08g011530.1Sb03g039960.1Sb03g039980.1Sb03g039970.1Sb05g026630.1
Sb03g009410.1Sb05g025570.1Sb02g000300.1
Thellungiella halophilaThhalv10020392mThhalv10020388mThhalv10013097mThhalv10013058mThhalv10015329m
Zea maysAC234190.1_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)