y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g25680.2
FamilyGT22
Protein PropertiesLength: 530 Molecular Weight: 61003.5 Isoelectric Point: 9.3656
ChromosomeChromosome/Scaffold: 03 Start: 32899680 End: 32915960
Descriptionhomolog of asparagine-linked glycosylation 12
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22544140
  SIAAVYVITVPYTKVEESFNVQAMHDILHHRLNLDNYDHLEFPGVVPRTFLGALLVSIIASPFVLTASLLHLPKFYALLIVRMALGGIVLYTLRFFRHQI
  RNKFGHQVEAFFVILTATQFHFLFYCTRPLPNILALSLVNLAYGYWFEGRFYAALNSLIFATAVLRCDMLLLLCPIGLQLLLTKKISVWGALKHCTGMAL
  FCIGLTILVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTHAFHWYFTSALPRSLLAAYPLSLFGLFVDRRVRSFTFPVLAFILLYSKLPHKELRFIISSV
  PIFNLSASIASNRIYNNKKKMIWNLLFLILLGLLLMSLAGTITSFMASYWNYPSGHALKEL
Full Sequence
Protein Sequence     Length: 530     Download
MKAQYFCKAH EAHFVFVSPL AFYTHSETNH TTMASSSKSK IFLQRYGYDF LLGSIAAVYV    60
ITVPYTKVEE SFNVQAMHDI LHHRLNLDNY DHLEFPGVVP RTFLGALLVS IIASPFVLTA    120
SLLHLPKFYA LLIVRMALGG IVLYTLRFFR HQIRNKFGHQ VEAFFVILTA TQFHFLFYCT    180
RPLPNILALS LVNLAYGYWF EGRFYAALNS LIFATAVLRC DMLLLLCPIG LQLLLTKKIS    240
VWGALKHCTG MALFCIGLTI LVDSIMWKRL LWPEFEVFWF NSVLNKSSEW GTHAFHWYFT    300
SALPRSLLAA YPLSLFGLFV DRRVRSFTFP VLAFILLYSK LPHKELRFII SSVPIFNLSA    360
SIASNRIYNN KKKMIWNLLF LILLGLLLMS LAGTITSFMA SYWNYPSGHA LKELHGIGFH    420
NDTDERWVHI DTFSAMNGIS RFCESEFPWR YSKEEQISLQ EFHQRNFTFL INEHPAINGF    480
KCLFTEDGFS RVRLKPGYPP ILLVKEPKVY VHGNLENQNI FSQNWPGCP*               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028162.0e-8256355100+
pfam03901Glyco_transf_222.0e-3062363318+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001077446.10335281493transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001077448.10335281497transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001117214.10775281453transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002448266.104952922500hypothetical protein SORBIDRAFT_06g024210 [Sorghum bicolor]
RefSeqXP_002526470.1027508113592glycosyltransferase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5466EC-2.4.1.258Dol-P-Man:Man5GlcNAc2-PP-Dol α-1,3-mannosyltransferase
Transmembrane Domains
StartEnd
4163
102124
131149
159178
183200
204226
239261
297319
375397
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL435541333694010
FG9923952542144670
EC955568271463160
EG4923072961234180
FS325042235312630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_053_00061.1Aquca_053_00061.4Aquca_053_00061.3Aquca_053_00061.5Aquca_053_00061.6
Aquca_053_00061.2
Arabidopsis lyrata887214
Arabidopsis thalianaAT1G02145.1AT1G02145.2AT1G02145.4AT1G02145.3
Brachypodium distachyonBradi5g17390.1
Brassica rapaBra032669
Capsella rubellaCarubv10011809m
Citrus clementinaCiclev10019843m
Citrus sinensisorange1.1g010983morange1.1g010929m
Cucumis sativusCucsa.362500.1Cucsa.362500.2Cucsa.362500.8
Eucalyptus grandisEucgr.E01545.1Eucgr.E01545.2
Fragaria vescamrna05309.1-v1.0-hybrid
Glycine maxGlyma07g13150.1Glyma03g25680.1
Gossypium raimondiiGorai.004G166900.2Gorai.004G166900.4Gorai.004G166900.1Gorai.004G166900.3
Linum usitatissimumLus10019399Lus10043256
Malus domesticaMDP0000237340.174.306MDP0000237340.174.306
Manihot esculentacassava4.1_007438m
Medicago truncatulaAC202489_19.1
Mimulus guttatusmgv1a005831m
Oryza sativaLOC_Os04g46050.3LOC_Os04g46050.1LOC_Os04g46050.2
Panicum virgatumPavirv00060929m
Physcomitrella patensPp1s33_69V6.2
Phaseolus vulgarisPhvul.010G045600.2Phvul.010G045600.4Phvul.010G045600.3Phvul.010G045600.1
Populus trichocarpaPotri.002G139200.1
Ricinus communis29709.m001172
Setaria italicaSi029826m
Selaginella moellendorffii91475
Sorghum bicolorSb06g024210.1
Thellungiella halophilaThhalv10007744mThhalv10007738mThhalv10007459m
Vitis viniferaGSVIVT01018298001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny