y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g27460.5
FamilyGH51
Protein PropertiesLength: 677 Molecular Weight: 73891.4 Isoelectric Point: 6.1533
ChromosomeChromosome/Scaffold: 03 Start: 35174527 End: 35184383
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH512096600
  KATDHNSRLQLTTTTKGVIWLDQVSAMPLDTYKGHGFRTDLVEMLTALKPRFIRFPGGCFVEGEWLRNAFRWKASVGPWEERPGHFGDVWMYWTDDGLGY
  YEFLQLAEDLGTAPIWVFNNGVSHNDQVDTSAVLPLVQEALDGLEFARGDRTSKWGSLRAAMGHPAPFDLRYVAVGNEDCGKKNYRGNYLKFYSAIKSAY
  PDIQIISNCDGSSRPLDHPADMYDYHVYTNANDMFSRANAFDHTSRNGPKAFVSEYAVTGKDAGTGSLLAALAEAGFLIGLEKNSDVIQMASYAPLFVNA
  NDRRWNPDAIVFNSFQLYGTPSYWVQVFFSESSGATLLSTSLQAPSSNSLVASAITFQNSVDKKNYIRIKVVNFGTTAVNLKISLDGLEPNSLQLSGSTK
  TVLTSANVMDENSFSQPKKVVPIQSLLQNVGKDMNVTVPPRSFTSFDLVKQS
Full Sequence
Protein Sequence     Length: 677     Download
MGSSKALCSV SLLHLFILVC LVFQCFATKK HADLTTTLTV NASDASGKPI PETLFGIFFE    60
EINHAGAGGL WAELVSNRGF EAGGPNTPSN IDPWSIIGNE SLINIETDRT SCFDRNKVAL    120
RLEVLCDSKG DNICPADGVG VYNPGFWGMN IEQGKKYKVV FYVRSTESLN LTVSLTGSNG    180
VGNLASSVIT GSALDFSNWT KVEKILVAKA TDHNSRLQLT TTTKGVIWLD QVSAMPLDTY    240
KGHGFRTDLV EMLTALKPRF IRFPGGCFVE GEWLRNAFRW KASVGPWEER PGHFGDVWMY    300
WTDDGLGYYE FLQLAEDLGT APIWVFNNGV SHNDQVDTSA VLPLVQEALD GLEFARGDRT    360
SKWGSLRAAM GHPAPFDLRY VAVGNEDCGK KNYRGNYLKF YSAIKSAYPD IQIISNCDGS    420
SRPLDHPADM YDYHVYTNAN DMFSRANAFD HTSRNGPKAF VSEYAVTGKD AGTGSLLAAL    480
AEAGFLIGLE KNSDVIQMAS YAPLFVNAND RRWNPDAIVF NSFQLYGTPS YWVQVFFSES    540
SGATLLSTSL QAPSSNSLVA SAITFQNSVD KKNYIRIKVV NFGTTAVNLK ISLDGLEPNS    600
LQLSGSTKTV LTSANVMDEN SFSQPKKVVP IQSLLQNVGK DMNVTVPPRS FTSFDLVKQS    660
STLKMAGSDS STRSSI*                                                   720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA2.0e-40244650481+
pfam06964Alpha-L-AF_C1.0e-44462650206+
smart00813Alpha-L-AF_C7.0e-54462650199+
Gene Ontology
GO TermDescription
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP97437.102067618675alpha-L-arabinofuranosidase [Malus x domestica]
GenBankABF22680.302067618677alpha-L-arabinofuranosidase [Prunus persica]
GenBankABV32544.102067618677alpha-L-arabinofuranosidase protein [Prunus persica]
DDBJBAF42035.1016761675alpha-Arabinosidase1 [Pyrus communis]
RefSeqXP_002523672.102567629678Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4atw_F5e-2024465648481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_E5e-2024465648481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_D5e-2024465648481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_C5e-2024465648481A Chain A, The Crystal Structure Of Arabinofuranosidase
PDB4atw_B5e-2024465648481A Chain A, The Crystal Structure Of Arabinofuranosidase
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7807404072726770
HO8526834152446560
HO8072913181514680
HO7959483323476770
JG577027336984330
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1Glyma03g00626.1
Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2Glyma19g30145.1
Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)