y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g28281.1
FamilyGH31
Protein PropertiesLength: 879 Molecular Weight: 100718 Isoelectric Point: 8.2817
ChromosomeChromosome/Scaffold: 03 Start: 36153280 End: 36159392
DescriptionGlycosyl hydrolases family 31 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH313978620
  LHGNSPCELIERSTESIGRLPELPEWIISGAIVGMQGGTDAVRHIWDELRTYDVPVSAFWLQDWVGQRETLIGSQLWWNWEVDAQRYWGWKELIKDLSSQ
  NIKVMTYCNPCLALVDKKQNKRRNLFEEAKKLDILVKDSNGNPYMVPNTAFDVGMLDLTHPKTATWFKQILREMVDDGVRGWMADFGEGLPVDAVLYSGE
  DPISAHNRYPELWAKINRELVEEWKSSSLDKVKEDEDEGLVFFMRAGFRDSPKWGMLFWEGDQMVSWQTNDGIKSSVVGLLSSGISGYAFNHSDIGGYCT
  VNLPIVKYRRSEELLLRWMELNSFTTVFRTHEGNKPSCNSQFYSNHQTMSHFARSAKVYKAWKFYRIQLVKEAAQKGLPICRHLFLHYPDDECVHRLSYQ
  QFLVGSEFLVVPVLDKGKKKVKAYFPLGESSSWIHIWTGKVFSKQGREEWVEAPIGYPAVFVKVGS
Full Sequence
Protein Sequence     Length: 879     Download
MAILKITKKH HKRFNNPFPS SVSTTIPYVQ GSLFFNSKRV PSDQTFSIGT DFHLSWTSNN    60
GGHLSISHLS HQTRPIWSTI PGQAFVSAAL VDTEVEESRG SFLVKDKDVH LVCNHQTIED    120
IRVIEDISQF DHHLECEVAD SPCVSQGLEK KSDAQEIHLP TLMITGRLFN MSKKSKRFQK    180
HGIQATMQFE AKGPSVYARY WVLFNQKGNH EVGFQVKIEK PNFVSRNQVS KKASGVYQGF    240
KRRLSNRKKR LDWCWYLSRP RGFVLVSSVE EEIGNLDIPK PEEFNRVWLT YASDENERFY    300
GFGEQFSHMN FKGKRVPIFV QEQGIGRGDQ PITLAANLIS YRAGGDWSTT YAPSPFYITS    360
KMRSVCLEGY DYTVFDLTRL DRVQIQIHGN SVEGRILHGN SPCELIERST ESIGRLPELP    420
EWIISGAIVG MQGGTDAVRH IWDELRTYDV PVSAFWLQDW VGQRETLIGS QLWWNWEVDA    480
QRYWGWKELI KDLSSQNIKV MTYCNPCLAL VDKKQNKRRN LFEEAKKLDI LVKDSNGNPY    540
MVPNTAFDVG MLDLTHPKTA TWFKQILREM VDDGVRGWMA DFGEGLPVDA VLYSGEDPIS    600
AHNRYPELWA KINRELVEEW KSSSLDKVKE DEDEGLVFFM RAGFRDSPKW GMLFWEGDQM    660
VSWQTNDGIK SSVVGLLSSG ISGYAFNHSD IGGYCTVNLP IVKYRRSEEL LLRWMELNSF    720
TTVFRTHEGN KPSCNSQFYS NHQTMSHFAR SAKVYKAWKF YRIQLVKEAA QKGLPICRHL    780
FLHYPDDECV HRLSYQQFLV GSEFLVVPVL DKGKKKVKAY FPLGESSSWI HIWTGKVFSK    840
QGREEWVEAP IGYPAVFVKV GSQVGETFLN NLRSLGIL*                           900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06593GH31_xylosidase_YicI7.0e-27473732260+
pfam01055Glyco_hydro_312.0e-66399862476+
COG1501COG15019.0e-74295864582+
cd06594GH31_glucosidase_YihQ4.0e-156414749337+
PRK10426PRK104260255876634+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD81144.10283878315932alpha-glucosidase -like [Oryza sativa Japonica Group]
EMBLCBI30134.10187835905unnamed protein product [Vitis vinifera]
RefSeqXP_002266626.1018781871PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308887.1018781875predicted protein [Populus trichocarpa]
RefSeqXP_002522166.1018781874alpha-xylosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1we5_F1e-28310833148639A Chain A, Crystal Structure Of Alpha-Xylosidase From Escherichia Coli
PDB1we5_E1e-28310833148639A Chain A, Crystal Structure Of Alpha-Xylosidase From Escherichia Coli
PDB1we5_D1e-28310833148639A Chain A, Crystal Structure Of Alpha-Xylosidase From Escherichia Coli
PDB1we5_C1e-28310833148639A Chain A, Crystal Structure Of Alpha-Xylosidase From Escherichia Coli
PDB1we5_B1e-28310833148639A Chain A, Crystal Structure Of Alpha-Xylosidase From Escherichia Coli
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY9756862824827630
JG4717202683846510
EL3732132753876610
DV1331912584677240
CN5243352403846230
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00336.5Aquca_014_00336.4Aquca_014_00336.3Aquca_014_00336.2Aquca_014_00336.1
Aquca_014_00336.6Aquca_026_00375.1Aquca_026_00374.1Aquca_026_00373.1Aquca_005_00561.8
Aquca_005_00561.7Aquca_005_00561.5Aquca_005_00561.4Aquca_005_00561.3Aquca_005_00561.2
Aquca_005_00561.1Aquca_005_00561.6Aquca_002_01146.1
Arabidopsis lyrata919683898886909139484972894626
865511862774
Arabidopsis thalianaAT5G63840.1AT3G23640.2AT3G23640.1AT5G11720.1AT3G45940.1
AT1G68560.1
Brachypodium distachyonBradi1g69780.1Bradi1g52510.1Bradi2g19280.1Bradi2g02070.1Bradi1g32650.1
Bradi2g10060.1
Brassica rapaBra024240Bra037754Bra028332Bra035407Bra004319
Bra006111Bra004031Bra028330
Carica papayaevm.model.supercontig_37.16evm.model.supercontig_1.180evm.model.supercontig_71.57evm.model.supercontig_5.162
Capsella rubellaCarubv10025824mCarubv10012876mCarubv10015582mCarubv10002711mCarubv10019747m
Chlamydomonas reinhardtiiCre03.g190500.t1.2Cre03.g194700.t1.3
Citrus clementinaCiclev10000200mCiclev10014196mCiclev10000152mCiclev10017610mCiclev10033422m
Ciclev10014274mCiclev10011016mCiclev10030449m.416.628Ciclev10030449m.416.628Ciclev10013535m
Ciclev10030449m.283.414Ciclev10030449m.283.414Ciclev10000404m.185.329Ciclev10000404m.185.329Ciclev10004303m
Citrus sinensisorange1.1g003671morange1.1g002442morange1.1g002568morange1.1g038998morange1.1g002256m
orange1.1g020492morange1.1g021825morange1.1g022976morange1.1g021612morange1.1g046216m
orange1.1g014924morange1.1g025445morange1.1g016744morange1.1g016738morange1.1g044305m
orange1.1g048354morange1.1g020723morange1.1g040705m
Cucumis sativusCucsa.228080.1Cucsa.322440.1Cucsa.236670.1Cucsa.365330.1Cucsa.283630.1
Cucsa.068450.1
Eucalyptus grandisEucgr.I00112.6Eucgr.I00112.5Eucgr.I00112.4Eucgr.I00112.3Eucgr.I00112.2
Eucgr.I00112.1Eucgr.E01212.2Eucgr.E01212.1Eucgr.K01952.1Eucgr.E01209.1
Eucgr.K01962.1Eucgr.K01954.1Eucgr.K01958.1Eucgr.L01888.1Eucgr.K01960.1
Eucgr.K01964.1Eucgr.L02199.1Eucgr.K01949.1Eucgr.G02327.1Eucgr.K01956.1
Eucgr.K01957.1Eucgr.K01953.1Eucgr.K01950.1Eucgr.L00881.1.54.343Eucgr.L00881.1.54.343
Eucgr.K01961.1Eucgr.L01889.1.188.355Eucgr.L01889.1.188.355Eucgr.L00881.1.347.493Eucgr.L00881.1.347.493
Eucgr.K01959.1Eucgr.A02235.1Eucgr.G00330.1
Fragaria vescamrna24190.1-v1.0-hybridmrna20103.1-v1.0-hybrid.273.739mrna20103.1-v1.0-hybrid.273.739mrna03754.1-v1.0-hybridmrna24638.1-v1.0-hybrid
mrna21878.1-v1.0-hybrid
Glycine maxGlyma04g38630.1Glyma06g16371.1Glyma09g03250.1Glyma15g14150.1Glyma04g14810.1
Glyma15g14140.2Glyma09g34850.1Glyma01g20460.1Glyma08g31890.1Glyma10g42140.1
Glyma15g14160.2
Gossypium raimondiiGorai.007G066900.6Gorai.007G066900.3Gorai.007G066900.2Gorai.007G066900.1Gorai.007G066900.4
Gorai.007G066900.5Gorai.009G115500.3Gorai.009G115500.1Gorai.005G124100.2Gorai.005G124100.1
Gorai.013G076300.2Gorai.013G076300.1Gorai.009G115500.2Gorai.007G368700.2Gorai.007G368700.1
Gorai.008G183500.2Gorai.008G183500.1Gorai.009G115500.4Gorai.013G001500.1Gorai.013G001500.2
Gorai.013G001500.3
Linum usitatissimumLus10033490Lus10020887Lus10038408Lus10008067Lus10034315
Lus10041457Lus10035020Lus10035019Lus10035671Lus10000779
Lus10000778Lus10021679Lus10031003
Malus domesticaMDP0000144090MDP0000178546MDP0000139428MDP0000894015MDP0000455477
MDP0000192721MDP0000208161MDP0000296747MDP0000169457MDP0000519142
MDP0000127634MDP0000776779MDP0000662421MDP0000238176
Manihot esculentacassava4.1_001195mcassava4.1_001191mcassava4.1_022477mcassava4.1_027331mcassava4.1_002192m
cassava4.1_001205mcassava4.1_001244mcassava4.1_001233mcassava4.1_002780mcassava4.1_006053m
cassava4.1_004250mcassava4.1_008696mcassava4.1_007575m
Medicago truncatulaMedtr3g096870.1AC235665_67.1Medtr5g026610.1Medtr5g057990.1Medtr2g031110.1.69.543
Medtr2g031110.1.69.543Medtr2g031110.1.69.543AC233660_42.1AC233660_28.1Medtr7g089780.1
Mimulus guttatusmgv1a001552mmgv1a001027mmgv1a001815mmgv1a001054mmgv1a000795m
mgv1a000741mmgv1a000940mmgv1a003100mmgv1a001294m
Oryza sativaLOC_Os03g11720.1LOC_Os06g46340.1LOC_Os06g46284.2LOC_Os06g46284.1LOC_Os07g23880.1
LOC_Os01g03950.1LOC_Os07g23944.1LOC_Os01g16310.1
Panicum virgatumPavirv00007084mPavirv00007083mPavirv00059282mPavirv00000653mPavirv00014847m
Pavirv00031858mPavirv00011190mPavirv00049442mPavirv00025581mPavirv00065694m
Pavirv00021444m
Physcomitrella patensPp1s109_267V6.2Pp1s109_267V6.1Pp1s5_330V6.1Pp1s242_48V6.1Pp1s140_141V6.1
Pp1s41_235V6.1Pp1s60_162V6.1Pp1s157_63V6.1Pp1s25_97V6.1Pp1s11_406V6.1
Pp1s80_200V6.1Pp1s86_178V6.1Pp1s13_451V6.1Pp1s264_36V6.1Pp1s264_60V6.1
Pp1s119_138V6.1Pp1s6_50V6.1Pp1s43_19V6.1Pp1s245_102V6.1Pp1s281_10V6.1
Pp1s41_238V6.1Pp1s65_69V6.1
Phaseolus vulgarisPhvul.009G153400.1Phvul.002G127000.1Phvul.006G125100.1Phvul.002G126900.1Phvul.003G035400.1
Phvul.007G026900.1Phvul.001G123000.1
Picea abiesMA_10430549g0010MA_102800g0010MA_110168g0010MA_9807255g0010MA_10426288g0010
MA_10431114g0020MA_10436707g0010MA_10431114g0010MA_10435316g0010MA_5372344g0010
Populus trichocarpaPotri.007G100000.1Potri.005G069000.1Potri.001G129600.4Potri.001G129600.2Potri.011G154200.1
Potri.011G154300.1Potri.001G129600.1Potri.011G154500.2Potri.011G154500.1Potri.001G442800.1
Potri.001G129600.3Potri.010G125800.1Potri.008G120000.2Potri.008G120000.1Potri.001G442800.2
Potri.006G039500.1Potri.001G442700.1
Prunus persicappa001032mppa001168mppa001103mppa001098mppa000927m
ppa001232m
Ricinus communis29687.m00059729827.m00260228458.m00004829776.m00046827524.m000301
29733.m00074634899.m00001952272.m000013
Setaria italicaSi034132mSi005827mSi028815mSi000221mSi000237m
Selaginella moellendorffii142083923397985582321
Sorghum bicolorSb01g042750.1Sb10g027110.1Sb03g007230.1Sb02g010060.1.193.392Sb02g010060.1.193.392
Sb02g010060.1.393.531Sb02g010060.1.393.531Sb03g010640.1.716.836Sb03g010640.1.716.836Sb03g010640.1.427.700
Sb03g010640.1.427.700
Thellungiella halophilaThhalv10003620mThhalv10019990mThhalv10019989mThhalv10012616mThhalv10012743m
Thhalv10018167mThhalv10018090m
Vitis viniferaGSVIVT01020935001GSVIVT01024287001GSVIVT01022815001GSVIVT01037959001.254.722GSVIVT01037959001.254.722
GSVIVT01011904001GSVIVT01036946001GSVIVT01033641001
Volvox carteriVocar20005557m
Zea maysAC203753.4_FGT006
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)