y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g28841.1
FamilyGH17
Protein PropertiesLength: 145 Molecular Weight: 16422.7 Isoelectric Point: 10.4919
ChromosomeChromosome/Scaffold: 03 Start: 36774398 End: 36775694
Descriptionbeta-1,3-glucanase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1711441.20512e-43
  MRIYDRNQQVLQALRGSSIELLLDLPNIDLQRVASSQDNANRWVQDNVKKFGNVRFRYFSMRNEVKPWDSFARFLVLAMQNIQRPISSVGLGNQIKVSTA
  IETGALAESYPPSRGSFRSDYRTAYLDGVIRFLVNNNAPLLVNV
Full Sequence
Protein Sequence     Length: 145     Download
MRIYDRNQQV LQALRGSSIE LLLDLPNIDL QRVASSQDNA NRWVQDNVKK FGNVRFRYFS    60
MRNEVKPWDS FARFLVLAMQ NIQRPISSVG LGNQIKVSTA IETGALAESY PPSRGSFRSD    120
YRTAYLDGVI RFLVNNNAPL LVNV*                                          180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00332Glyco_hydro_178.0e-431132133+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAB03501.10114464208beta-1,3-glucanase [Glycine max]
GenBankAAS09829.10114418162endo-beta-1,3-glucanase [Glycine tabacina]
GenBankAAS09831.10114411155endo-beta-1,3-glucanase [Glycine falcata]
GenBankAAS09832.10114423167endo-beta-1,3-glucanase [Glycine soja]
GenBankAAS09838.10114423167endo-beta-1,3-glucanase [Glycine soja]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A1e-39114430173A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D1e-38114431177A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C1e-38114431177A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B1e-38114431177A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A1e-38114431177A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FS24999913211320
BM14336612511240
EH22112413211310
FS23924012611260
FS25054012611260
Orthologous Group
SpeciesID
Arabidopsis lyrata326432.33.170326432.33.170910092
Brassica rapaBra014643Bra014639
Carica papayaevm.model.supercontig_49.128.28.175evm.model.supercontig_49.128.28.175evm.model.supercontig_49.126
Citrus sinensisorange1.1g038030morange1.1g046781morange1.1g046740m
Fragaria vescamrna21954.1-v1.0-hybrid.12.119mrna21954.1-v1.0-hybrid.12.119mrna05671.1-v1.0-hybrid.102.226mrna05671.1-v1.0-hybrid.102.226
Glycine maxGlyma11g10061.1.17.94Glyma11g10061.1.17.94
Gossypium raimondiiGorai.008G159300.2.29.126Gorai.008G159300.2.29.126Gorai.010G003400.1.49.154Gorai.010G003400.1.49.154
Malus domesticaMDP0000609149.30.144MDP0000247130.167.242MDP0000247130.167.242MDP0000577118MDP0000275579
MDP0000281216MDP0000609149.30.144
Manihot esculentacassava4.1_023209m
Medicago truncatulaMedtr2g034440.2.22.152Medtr2g034440.2.22.152
Panicum virgatumPavirv00034981m
Picea abiesMA_1006327g0010MA_837697g0010MA_6944718g0010MA_10383303g0010MA_219456g0010.27.188
MA_9530584g0020MA_688105g0010MA_219456g0010.27.188MA_100289g0010MA_10429961g0010
MA_10435462g0010MA_4654636g0010MA_207447g0010MA_10309446g0010
Populus trichocarpaPotri.016G042800.1
Prunus persicappa022480m
Ricinus communis30147.m013731.287.42730147.m013731.287.427
Thellungiella halophilaThhalv10015274m
Vitis viniferaGSVIVT01031544001.30.128GSVIVT01031543001.30.126GSVIVT01031543001.30.126GSVIVT01033543001GSVIVT01033540001
GSVIVT01031542001.43.122GSVIVT01031542001.43.122GSVIVT01031544001.30.128
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny