y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g35610.3
FamilyGT41
Protein PropertiesLength: 920 Molecular Weight: 102181 Isoelectric Point: 5.6506
ChromosomeChromosome/Scaffold: 03 Start: 42759192 End: 42772888
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT413738440
  QGKVDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGDIARAINAYEQCLKIDPDSRNAGQNRLLAMNYIEEGHDDTLFEVHRDWGRRFMRLYPQYTSWDN
  SKDPERPLVIGYVSPDYFTHSVSYFIETPLVYHDYSNFKVIVYSAVVKADSKTIRFREKVLNKGGIWKDIYGIDEKRVANMVREDQVDILVELTGHTASN
  KLGMMACRPAPIQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELVRLPECFLCYTPSPEAGPICPTPALSNGFVTFGSFNNLAKITPKVLQVWA
  RILCAIPNSRLVVKCKPFCSDSVRQRFLSTLEQLGLEPLRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVS
  LLSKVGLEHLIARNEDEYVELAQQLASDISALQNLRMSLRNLMSKSPLCDGAKFILGLESTYRKMWHRYCRG
Full Sequence
Protein Sequence     Length: 920     Download
MAGADINSDG NGSERELAGN SYNGFAEAPE ASVSASGCEG NDSVSYANVL RSRNKFVDAL    60
SIYERVLESD GANVEALIGK GICLQMQNKG RLAYESFSEA IKVDPQNACA LTHCGILHKD    120
EGRLVEAAES YQKALQVDPS YKAAAECLAI VLTDIGTNIK LAGNTQDGIQ KYFEALKVDP    180
HYAPAYYNLG VVYSEMMQYD TALSFYEKAA SERPIYAEAY CNMGVIFKNR GDLESAITCY    240
ERCLTVSPNF EIAKNNMAIA LTDLGTKVKL EGDINQGVTL YKKALYYNWH YADAMYNLGV    300
AYGEMLKFDM AIVFYELAFH FNPHCAEACN NLGVIYKDRE NLDKAVECYQ LALSIKPNFS    360
QSLNNLGVVY TVQGKVDAAA SMIEKAIIAN PTYAEAYNNL GVLYRDAGDI ARAINAYEQC    420
LKIDPDSRNA GQNRLLAMNY IEEGHDDTLF EVHRDWGRRF MRLYPQYTSW DNSKDPERPL    480
VIGYVSPDYF THSVSYFIET PLVYHDYSNF KVIVYSAVVK ADSKTIRFRE KVLNKGGIWK    540
DIYGIDEKRV ANMVREDQVD ILVELTGHTA SNKLGMMACR PAPIQVTWIG YPNTTGLPTI    600
DYRITDSLAD PPETKQKHVE ELVRLPECFL CYTPSPEAGP ICPTPALSNG FVTFGSFNNL    660
AKITPKVLQV WARILCAIPN SRLVVKCKPF CSDSVRQRFL STLEQLGLEP LRVDLLPLIL    720
LNHDHMQAYS LMDISLDTFP YAGTTTTCES LYMGVPCVTM AGSVHAHNVG VSLLSKVGLE    780
HLIARNEDEY VELAQQLASD ISALQNLRMS LRNLMSKSPL CDGAKFILGL ESTYRKMWHR    840
YCRGDVPSLK RLELLQEVAT GDLSNKNSEP TRIANSREDS PGSVKANGYN TIPASKLNIH    900
TREENDGSSN HSSKQGKMS*                                                960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00189TPR4.0e-1715124999+
cd00189TPR5.0e-1926035899+
cd00189TPR3.0e-22327426100+
COG3914Spy8.0e-90309841562+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
Swiss-ProtO8203901191910932SPY_PETHY RecName: Full=Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY; AltName: Full=PhSPY
RefSeqXP_002281883.10109059911PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308458.1079196934predicted protein [Populus trichocarpa]
RefSeqXP_002323412.1079016913predicted protein [Populus trichocarpa]
RefSeqXP_002530535.10119198930o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D3e-362586309386B Chain B, Crystal Structure Of T-Cell Receptor V Beta Domain Variant Complexed With Superantigen Sec3 Mutant
PDB4gz6_D2e-23652847524715B Chain B, Crystal Structure Of T-Cell Receptor V Beta Domain Variant Complexed With Superantigen Sec3 Mutant
PDB4gz6_D1e-171052616155B Chain B, Crystal Structure Of T-Cell Receptor V Beta Domain Variant Complexed With Superantigen Sec3 Mutant
PDB4gz6_D0.0000000000000316329923152B Chain B, Crystal Structure Of T-Cell Receptor V Beta Domain Variant Complexed With Superantigen Sec3 Mutant
PDB4gz6_D0.0000000000033234336116B Chain B, Crystal Structure Of T-Cell Receptor V Beta Domain Variant Complexed With Superantigen Sec3 Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY2954084014228190
HO7812093614858450
HO7812091183855020
HO781209692042700.0002
HO781209583223774.8
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.2Glyma02g36210.4
Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)