y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g36390.2
FamilyAA7
Protein PropertiesLength: 478 Molecular Weight: 52666.6 Isoelectric Point: 7.0769
ChromosomeChromosome/Scaffold: 03 Start: 43361955 End: 43373030
DescriptionFAD-linked oxidases family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA71463418.5e-28
  NIPDVIVYPRSEEEVSKIVKLCNSHKVPIVPYGGATSIEGHTLSPHGGVCIDMSLMKRVKELHVNDMDVVVEPGIGWMELNEYLEPYGLFFPLDPGPGAS
  IGGMCATRCSGSLAVRYGTMRDNVISLKVVLANGDIVKTASRARKSAAGYDLTRLMIGSEGTLGVITEVTLRLQKIPQYSVVAMCNFPSVKDAADV
Full Sequence
Protein Sequence     Length: 478     Download
MSFFVSFDVN SMSNFSSWYS RFRFSAKYLY CYHRTLHKNA PSTIFNNHGT RKNAWPTSLL    60
PLALAVSAGS LALQPHFNPS FCDTDDRGVG VGGKGSTQYV VKGSQKEFPR ELLQDLKIVC    120
QDNISLDYDE RYIHGKPQNS FHKAVNIPDV IVYPRSEEEV SKIVKLCNSH KVPIVPYGGA    180
TSIEGHTLSP HGGVCIDMSL MKRVKELHVN DMDVVVEPGI GWMELNEYLE PYGLFFPLDP    240
GPGASIGGMC ATRCSGSLAV RYGTMRDNVI SLKVVLANGD IVKTASRARK SAAGYDLTRL    300
MIGSEGTLGV ITEVTLRLQK IPQYSVVAMC NFPSVKDAAD VAIATMMSGI QVSRVELLDE    360
VQVKAINIAN GKNLPECPTL MFEFIGTEAY AREQTQIVRK LVSEHNGSDF VFAEEPEAKK    420
ELWKVRKEAL WACFAMEPNL VAMTTDVCVP LSHLGDLISR SKKELDASPL VCNCACW*      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK11230PRK112301.0e-33147443301+
pfam01565FAD_binding_48.0e-45148284139+
TIGR00387glcD6.0e-67151459313+
COG0277GlcD2.0e-95117476370+
PLN02805PLN02805078472395+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK24997.1091472102483unknown [Picea sitchensis]
RefSeqNP_568170.10154733471FAD linked oxidase family protein [Arabidopsis thaliana]
RefSeqXP_002267321.10154723469PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002322755.10914731383predicted protein [Populus trichocarpa]
RefSeqXP_002524111.10154733459d-lactate dehydrogenase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3pm9_F2e-3015046154370A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_E2e-3015046154370A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_D2e-3015046154370A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_C2e-3015046154370A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
PDB3pm9_B2e-3015046154370A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution
Metabolic Pathways
Pathway NameReactionECProtein Name
photorespirationRXN-969EC-1.1.3glycolate oxidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2650383181624770
DT7476372821914720
EX4408083311244540
FE6911232601063650
EL444323285923760
Orthologous Group
SpeciesID
Arabidopsis lyrata487468
Brassica rapaBra009208
Carica papayaevm.model.supercontig_222.7
Capsella rubellaCarubv10000524m
Citrus clementinaCiclev10011373m
Citrus sinensisorange1.1g011962morange1.1g015664morange1.1g015624morange1.1g008252m
Cucumis sativusCucsa.242270.1
Eucalyptus grandisEucgr.A02536.1
Fragaria vescamrna18037.1-v1.0-hybrid
Glycine maxGlyma03g36390.1
Gossypium raimondiiGorai.006G146800.1
Malus domesticaMDP0000293317MDP0000201766
Manihot esculentacassava4.1_004573m
Mimulus guttatusmgv1a003632m
Physcomitrella patensPp1s18_85V6.1
Phaseolus vulgarisPhvul.001G199000.1
Picea abiesMA_9447266g0050
Populus trichocarpaPotri.016G064800.13Potri.016G064800.1Potri.016G064800.10Potri.016G064800.11Potri.016G064800.2
Potri.016G064800.3Potri.016G064800.4Potri.016G064800.5Potri.016G064800.6Potri.016G064800.7
Potri.016G064800.8Potri.016G064800.9Potri.016G064800.12
Prunus persicappa003803m
Ricinus communis29333.m001099
Thellungiella halophilaThhalv10013121m
Vitis viniferaGSVIVT01022507001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny