y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g38750.2
FamilyCE8
Protein PropertiesLength: 503 Molecular Weight: 56317.7 Isoelectric Point: 8.3859
ChromosomeChromosome/Scaffold: 03 Start: 45050953 End: 45053147
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82074510
  NVVVAQYGRRHLSTIADSVLNACPKNKTIACVIYVKRGKYEKRVVIPKGVNQVFMYGDGPAHTIVTDSNTRDPKTLTTSFRAATFVVMGKGFICKDMGFT
  APADIGGAPTLLVLSDHSAFFNCKIDGNEGTLLAVAQRQFYRDCEILGRVTQNSHIIVKPRNSSDLVLRRNVVSAQSRLDKHQTTGLVIQNYTITAHGQN
  MNTLNATTYLRSPYSEYSRTIIMESFIGDVIHPKGWCKWSDNAIE
Full Sequence
Protein Sequence     Length: 503     Download
MDDDSKEKER LTFNIAIMVA SMIAIAMVTV SVVAHTDGPK QDAGKNVKTL LSVCSKTEDP    60
ESCFRMLKHV GEKATVLKAA INATLTELLL QESYKDCLEL LSLGIEELQS LYFVASFHVE    120
LCKLNLDDVM NSLSAVISYE VLGYSLKVPV LLTRIALSIV HNFSERPNRR EARLMLEEFP    180
RWFPATERKM IESNQGDNGG GEQWPINVVV AQYGRRHLST IADSVLNACP KNKTIACVIY    240
VKRGKYEKRV VIPKGVNQVF MYGDGPAHTI VTDSNTRDPK TLTTSFRAAT FVVMGKGFIC    300
KDMGFTAPAD IGGAPTLLVL SDHSAFFNCK IDGNEGTLLA VAQRQFYRDC EILGRVTQNS    360
HIIVKPRNSS DLVLRRNVVS AQSRLDKHQT TGLVIQNYTI TAHGQNMNTL NATTYLRSPY    420
SEYSRTIIME SFIGDVIHPK GWCKWSDNAI ETRTDKRVKW NGYSTIFERD QMVSYTVGRF    480
VQTDQWLLNR GIPYEIGFLV QN*                                            540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02314PLN023145.0e-62178495346+
PLN02217PLN022174.0e-622502575+
PLN02468PLN024683.0e-6639498531+
PLN02745PLN027453.0e-7731497550+
pfam01095Pectinesterase4.0e-83207484306+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26012.103649836567unnamed protein product [Vitis vinifera]
RefSeqXP_002274176.104649843563PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002275000.103649836567PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002519324.105249854567Pectinesterase-3 precursor, putative [Ricinus communis]
RefSeqXP_002528621.104149840566Pectinesterase-4 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A02074984315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A6.99949e-422074988319A Chain A, Pectin Methylesterase From Carrot
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR1949612792384870
DY9189392932384970
DY9182312932384970
DT7545292902384980
DY9184272882434970
Orthologous Group
SpeciesID
Glycine maxGlyma19g41350.1
Medicago truncatulaMedtr7g111560.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny