y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma03g41760.1
FamilyGH18
Protein PropertiesLength: 419 Molecular Weight: 47024.4 Isoelectric Point: 9.3906
ChromosomeChromosome/Scaffold: 03 Start: 47160593 End: 47166810
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18904099.8e-34
  PVLGYITPWNSRGYELAKRFNSKFTHLSPIWYDLKSQQTSLVLEGRHNADRGWISELKKAGEALILPRVVLEASPAVLLGKEKQRNKAINLIVTECKEMG
  YDGIVLESWSRWAAYGILHDPSMRNLALQFVKQLGDALHSISSEKISGQQLQLVYVIGSPSEKLQEHDFGPKDLETLSEAVDGFSLMTYDFSNPHNPGPN
  APLKWIQIVLQLLLGTSGNRAQSLAPKILLGINFYGNDFSLSRDADAGGGAIIGRDYLALLEKHWPELQWDKNSGEHFFFYTDDKDIRHVVFYPSLKSIS
  LRLEEARSWGCGISIWEIGQ
Full Sequence
Protein Sequence     Length: 419     Download
MAKKRSAPSG GRRENRAESS SRRLNSASGR RKLVAFFIVS SIIAIVTYRY RFRQSSPSQG    60
LVTTHANCQH ILAENSKVSG NSSQRHYTYP VLGYITPWNS RGYELAKRFN SKFTHLSPIW    120
YDLKSQQTSL VLEGRHNADR GWISELKKAG EALILPRVVL EASPAVLLGK EKQRNKAINL    180
IVTECKEMGY DGIVLESWSR WAAYGILHDP SMRNLALQFV KQLGDALHSI SSEKISGQQL    240
QLVYVIGSPS EKLQEHDFGP KDLETLSEAV DGFSLMTYDF SNPHNPGPNA PLKWIQIVLQ    300
LLLGTSGNRA QSLAPKILLG INFYGNDFSL SRDADAGGGA IIGRDYLALL EKHWPELQWD    360
KNSGEHFFFY TDDKDIRHVV FYPSLKSISL RLEEARSWGC GISIWEIGQG LDYFFDLL*     420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00704Glyco_hydro_188.0e-1091409363+
COG3858COG38585.0e-2583418348+
smart00636Glyco_184.0e-2891409349+
cd02874GH18_CFLE_spore_hydrolase2.0e-3491418352+
cd02876GH18_SI-CLP2.0e-14487418338+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN82499.1014181516hypothetical protein [Vitis vinifera]
EMBLCBI40499.1014181435unnamed protein product [Vitis vinifera]
RefSeqNP_192013.105941872430glycosyl hydrolase family 18 protein [Arabidopsis thaliana]
RefSeqXP_002320856.106041843399predicted protein [Populus trichocarpa]
RefSeqXP_002523373.105941874432chitinase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3bxw_A05941848393B Chain B, Crystal Structure Of Stabilin-1 Interacting Chitinase-Like Protein, Si-Clp
PDB3bxw_B05941848393B Chain B, Crystal Structure Of Stabilin-1 Interacting Chitinase-Like Protein, Si-Clp
PDB3cz8_B0.0000000416740789308A Chain A, Crystal Structure Of Putative Sporulation-Specific Glycosylase Ydhd From Bacillus Subtilis
PDB3cz8_A0.0000000416740789308A Chain A, Crystal Structure Of Putative Sporulation-Specific Glycosylase Ydhd From Bacillus Subtilis
Transmembrane Domains
StartEnd
3350
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG93130927012600
DY274582306333300
FG9313102221994190
EY6662432631544150
DY272714269332930
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00129.1
Arabidopsis lyrata352729
Arabidopsis thalianaAT4G01040.1
Brachypodium distachyonBradi2g43770.1
Brassica rapaBra000939
Carica papayaevm.model.supercontig_273.9
Capsella rubellaCarubv10001405m
Chlamydomonas reinhardtiiCre03.g200650.t1.1
Citrus clementinaCiclev10020231m
Citrus sinensisorange1.1g014108morange1.1g014001m
Cucumis sativusCucsa.259130.2Cucsa.259130.1
Eucalyptus grandisEucgr.E00067.1
Fragaria vescamrna19212.1-v1.0-hybrid
Glycine maxGlyma03g41760.2Glyma19g44401.1
Gossypium raimondiiGorai.008G124300.1
Linum usitatissimumLus10005946Lus10029447
Malus domesticaMDP0000223446MDP0000126058
Manihot esculentacassava4.1_001521m
Medicago truncatulaMedtr5g025480.1
Mimulus guttatusmgv1a010899m
Oryza sativaLOC_Os01g43220.1
Panicum virgatumPavirv00054484mPavirv00033212m
Physcomitrella patensPp1s162_65V6.1
Phaseolus vulgarisPhvul.006G111900.1
Picea abiesMA_557825g0010
Populus trichocarpaPotri.014G096700.1Potri.014G096700.2Potri.014G096700.4Potri.014G096700.3
Prunus persicappa006146m
Ricinus communis29742.m001446
Setaria italicaSi002099m
Selaginella moellendorffii249085240
Sorghum bicolorSb03g028160.1
Thellungiella halophilaThhalv10028671m
Vitis viniferaGSVIVT01027076001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny