y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma04g00610.2
FamilyGH10
Protein PropertiesLength: 455 Molecular Weight: 52024.8 Isoelectric Point: 6.2778
ChromosomeChromosome/Scaffold: 04 Start: 354292 End: 357709
DescriptionGlycosyl hydrolase family 10 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH101103860
  SKDFPFGSAIAKTILGNLPYQNWFVKRFNAAVFENELKWYATEPDEGKVNYTISDQMLQFVRTNNIIARGHNIFWENPKYTPPWVLNLTGTKLQSAVNSR
  IHSLMSQYKDEFIHWDVSNEMLHFNFYEERLGPDATLHFFETAHESDPLATLFMNDFNVVETCSDVKSTVDAYISRVRELQRNGIFMDGIGLEGHFTIPN
  PPLIRAILDKLATLGLPIWLTEVDISKTLDRDAQANYLEEVLREGFSHPSVNGIMLWTAFHPNGCYQMCLTDNNFKN
Full Sequence
Protein Sequence     Length: 455     Download
MVRTTLETEK ETHDCIGTVS AKHECWSFLK GGFVLNWSSN LSMIFFQNAD GKDINIDVAS    60
PSLQPFTKQQ WRINQQYKIN TQRKRAVTIH VSDSNGRRFQ GASICIEQIS KDFPFGSAIA    120
KTILGNLPYQ NWFVKRFNAA VFENELKWYA TEPDEGKVNY TISDQMLQFV RTNNIIARGH    180
NIFWENPKYT PPWVLNLTGT KLQSAVNSRI HSLMSQYKDE FIHWDVSNEM LHFNFYEERL    240
GPDATLHFFE TAHESDPLAT LFMNDFNVVE TCSDVKSTVD AYISRVRELQ RNGIFMDGIG    300
LEGHFTIPNP PLIRAILDKL ATLGLPIWLT EVDISKTLDR DAQANYLEEV LREGFSHPSV    360
NGIMLWTAFH PNGCYQMCLT DNNFKNLPAG DVVDKLVEEW QISRVEGVTD VHGSYSFYGF    420
LGEYRISVKY GNKTTKSTFS LSRGDETRHF TITI*                               480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3693XynA3.0e-42108366282+
pfam00331Glyco_hydro_102.0e-67107366276+
smart00633Glyco_101.0e-81146393269+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF94922.10145417470Glycosyl hydrolase family 10 protein, expressed [Oryza sativa (japonica cultivar-group)]
EMBLCBI37893.102454173625unnamed protein product [Vitis vinifera]
RefSeqNP_195577.202454108562glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
RefSeqXP_002277675.10245497549PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002534153.10145420473Endo-1,4-beta-xylanase A precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1v6y_A2e-3011536616275A Chain A, Crystal Structure Of Chimeric Xylanase Between Streptomyces Olivaceoviridis E-86 Fxyn And Cellulomonas Fimi Cex
PDB2g4f_B3e-3011536616266A Chain A, Crystal Structure Of Chimeric Xylanase Between Streptomyces Olivaceoviridis E-86 Fxyn And Cellulomonas Fimi Cex
PDB2g4f_A3e-3011536616266A Chain A, Crystal Structure Of Chimeric Xylanase Between Streptomyces Olivaceoviridis E-86 Fxyn And Cellulomonas Fimi Cex
PDB2g3j_A3e-3011536616266A Chain A, Crystal Structure Of Chimeric Xylanase Between Streptomyces Olivaceoviridis E-86 Fxyn And Cellulomonas Fimi Cex
PDB2g3i_A3e-3011536616266A Chain A, Structure Of S.Olivaceoviridis Xylanase Q88aR275A MUTANT
Metabolic Pathways
Pathway NameReactionECProtein Name
(1,4)-β-xylan degradation3.2.1.8-RXNEC-3.2.1.8endo-1,4-β-xylanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX7055412382184550
ES8033392531003520
GR953916292893800
DY0240352631694280
EL3614892671514160
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00095.4.344.628Aquca_017_00095.3.344.628Aquca_017_00095.2.564.848Aquca_017_00095.1.577.861Aquca_006_00211.1
Aquca_003_00413.1Aquca_011_00218.1.200.461Aquca_011_00219.1.223.486Aquca_006_00211.2
Arabidopsis lyrata475392.571.844489729.403.684490628913024.223.481491296
491295.221.480353449353450480358
Arabidopsis thalianaAT1G58370.1.570.844AT4G08160.1.404.685AT4G08160.2.404.657AT4G38650.1AT4G38300.1
AT4G33830.1.222.485AT4G33840.1.222.480AT4G33860.1.222.480AT4G33820.1AT4G33810.1
AT2G14690.1
Brachypodium distachyonBradi1g12710.1.410.670Bradi2g02320.1.243.531Bradi2g02330.1Bradi1g27257.1.195.481Bradi5g04640.1
Bradi1g68310.1Bradi3g24410.1Bradi1g71040.1.232.494Bradi1g71076.1Bradi1g71050.1
Brassica rapaBra031698.712.996Bra027867.572.849Bra039768.635.918Bra010733Bra017609.315.575
Bra034585.221.481Bra034584.220.481Bra034586Bra036392Bra017610
Carica papayaevm.model.supercontig_160.18.423.706evm.model.supercontig_160.19.570.841evm.model.supercontig_37.165evm.model.supercontig_106.45.230.491evm.model.supercontig_169.45
evm.model.supercontig_106.44
Capsella rubellaCarubv10008217m.613.898Carubv10019737m.593.868Carubv10000293m.404.688Carubv10004489mCarubv10004963m
Carubv10006586m.221.480Carubv10006745mCarubv10004408mCarubv10015996m
Citrus clementinaCiclev10000171m.611.880Ciclev10030219mCiclev10028121mCiclev10030382m.227.489Ciclev10028089m
Citrus sinensisorange1.1g002447m.574.843orange1.1g036715morange1.1g035723morange1.1g042396morange1.1g008838m
Cucumis sativusCucsa.353160.7.566.835Cucsa.353160.4.599.868Cucsa.353160.1.599.868Cucsa.353160.8.341.611Cucsa.143690.1.601.869
Cucsa.169000.1Cucsa.219120.1Cucsa.298380.1
Eucalyptus grandisEucgr.F00109.1.537.816Eucgr.F00108.3.544.819Eucgr.F00108.2.583.858Eucgr.F00108.1.587.862Eucgr.F02205.1.452.713
Eucgr.I01059.1Eucgr.G01773.1Eucgr.I01060.1Eucgr.I01061.1Eucgr.G01210.1
Eucgr.G01205.1Eucgr.G01215.1Eucgr.G01214.1Eucgr.G01217.1Eucgr.G01206.1
Eucgr.G01213.1Eucgr.G01209.1
Fragaria vescamrna02649.1-v1.0-hybrid.593.860mrna07626.1-v1.0-hybridmrna25505.1-v1.0-hybrid.713.976mrna25505.1-v1.0-hybrid.713.976mrna25505.1-v1.0-hybrid.713.976
mrna28152.1-v1.0-hybrid.228.491mrna25508.1-v1.0-hybrid.175.436mrna25505.1-v1.0-hybrid.226.484mrna25505.1-v1.0-hybrid.226.484mrna25505.1-v1.0-hybrid.226.484
Glycine maxGlyma14g10456.2.555.825Glyma14g10456.1.584.854Glyma06g05290.1.396.666Glyma04g05220.3.395.665Glyma04g05220.2.395.665
Glyma17g35060.2.585.853Glyma17g35060.1.556.824Glyma06g00680.1Glyma04g00610.1Glyma11g11220.1.211.472
Glyma11g11200.1.222.493Glyma20g27040.1Glyma10g40300.2Glyma10g40300.1Glyma10g40293.1
Gossypium raimondiiGorai.009G223500.6.425.707Gorai.009G223500.5.565.847Gorai.009G223500.4.564.846Gorai.009G223500.3.565.847Gorai.009G223500.2.564.846
Gorai.009G223500.1.565.847Gorai.009G223600.1.421.696Gorai.010G029100.1.585.855Gorai.005G231200.1Gorai.008G020100.2
Gorai.008G020100.1Gorai.005G231100.2Gorai.005G231100.1Gorai.002G195600.1.359.528Gorai.002G195600.1.359.528
Gorai.002G195600.1.359.528Gorai.002G195600.1.168.257Gorai.002G195600.1.168.257Gorai.002G195600.1.168.257Gorai.002G195600.1.280.355
Gorai.002G195600.1.280.355Gorai.002G195600.1.280.355
Linum usitatissimumLus10007242.429.712Lus10028242.428.711Lus10025054Lus10033786.213.477Lus10014642.218.482
Lus10020985.202.471Lus10033784Lus10034490Lus10014646
Malus domesticaMDP0000225641.598.870MDP0000246856MDP0000249571MDP0000245498.229.493MDP0000144523
MDP0000779011MDP0000146624.768.905MDP0000146624.768.905MDP0000132261MDP0000146624.669.763
MDP0000146624.669.763
Manihot esculentacassava4.1_002200m.411.692cassava4.1_001250m.571.847cassava4.1_001252m.573.850cassava4.1_001320m.557.841cassava4.1_033386m
cassava4.1_029937mcassava4.1_021918m.217.482cassava4.1_021990mcassava4.1_028847mcassava4.1_026436m
Medicago truncatulaMedtr3g117800.1Medtr7g024420.1Medtr1g106800.1Medtr1g106790.1Medtr1g106910.1
Medtr1g106770.1
Mimulus guttatusmgv1a027071m.549.820mgv1a000981m.578.858mgv1a020606mmgv1a003597m.225.485mgv1a023132m
mgv1a024427mmgv1a003542mmgv1a019481mmgv1a025021mmgv1a022322m
mgv1a004157mmgv1a004760mmgv1a021702mmgv1a004887m
Oryza sativaLOC_Os03g47010.1.411.694LOC_Os01g04300.1.211.499LOC_Os01g04290.1LOC_Os05g25560.1LOC_Os05g23350.1
LOC_Os03g14010.3LOC_Os03g14010.2LOC_Os03g14010.1LOC_Os05g23924.2LOC_Os05g23924.1
LOC_Os03g10469.2LOC_Os03g10469.1LOC_Os10g21110.1LOC_Os03g10440.1.227.490LOC_Os03g10478.1.232.497
LOC_Os10g21100.1
Panicum virgatumPavirv00018091m.408.690Pavirv00043679m.401.686Pavirv00043214mPavirv00009472m.233.513Pavirv00011920m
Pavirv00064836mPavirv00011543mPavirv00004670mPavirv00012621mPavirv00003316m
Pavirv00046655mPavirv00001379mPavirv00041480mPavirv00066390mPavirv00041724m
Pavirv00066756mPavirv00064807mPavirv00011965mPavirv00070694m.721.846Pavirv00049463m
Pavirv00011967mPavirv00011966mPavirv00027101m.191.313Pavirv00026745m.214.317
Physcomitrella patensPp1s121_107V6.1.717.999
Phaseolus vulgarisPhvul.009G075400.1.397.677Phvul.001G032300.2.556.827Phvul.001G032300.1.583.854Phvul.009G120500.1Phvul.011G033100.1.217.499
Phvul.007G045400.1Phvul.007G045500.1Phvul.007G045900.1
Picea abiesMA_9039435g0010.206.470MA_350255g0010MA_604666g0010MA_10433351g0010MA_9354042g0010
MA_429144g0010.244.407MA_8357324g0010
Populus trichocarpaPotri.002G113100.2.412.693Potri.004G173300.4Potri.004G173300.3Potri.004G173300.2Potri.004G173300.1
Potri.009G087900.1.202.466Potri.009G087800.3Potri.009G087800.2Potri.009G087800.1Potri.009G087700.2
Potri.009G087700.1Potri.009G087600.1
Prunus persicappa001089m.567.845ppa004290mppa016947mppa021363m.219.483ppa023031m
ppa024827m
Ricinus communis30170.m013644.481.75830170.m01364629492.m00007029812.m00019629812.m000195.218.483
29812.m00019429812.m00019958888.m000026
Setaria italicaSi038956m.406.689Si000821mSi000630m.297.586Si025026mSi034995m.207.495
Si001255mSi034968mSi039948mSi034867m.230.491Si039549m
Si039641mSi034912m.223.486
Selaginella moellendorffii111304.535.794420481.257.518
Sorghum bicolorSb01g012210.1.405.688Sb03g006980.1.246.530Sb03g006950.1.218.506Sb04g020543.1Sb01g041310.1
Sb06g003350.1Sb01g043760.1Sb02g004490.1Sb01g043730.1Sb01g043720.1
Thellungiella halophilaThhalv10023244m.581.848Thhalv10028466m.388.667Thhalv10024805mThhalv10027468m.221.481Thhalv10024995m.219.458
Thhalv10023172m
Vitis viniferaGSVIVT01009272001.602.834GSVIVT01024049001GSVIVT01037833001.244.520GSVIVT01037833001.244.520GSVIVT01037832001
GSVIVT01037825001.197.461
Volvox carteriVocar20000377mVocar20006952m
Zea maysAC204711.3_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)