y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma04g01950.2
FamilyGH13
Protein PropertiesLength: 899 Molecular Weight: 101593 Isoelectric Point: 4.7575
ChromosomeChromosome/Scaffold: 04 Start: 1335714 End: 1344458
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132866114.8e-29
  LPRIRANNYNTVQLMAVMEHSYYASFGYHVTNFFAVSSRSGTPEDLKYLIDKAHSLGLQVLMDVIHSHASNNVTDGLNGFDVGQTSQDSYFHTGDRGYHK
  LWDSRLFNYANWEVLRFLLSNLRWWLEEFKFDGFRFDGVTSMLYHHHGINIAFTGDYNEYFSEATDVDAVVYLMLANCLIHSILPDATVIAEDVSGMPGL
  GQPVSDGGIGFDYRLAMAIPDKWIDYLKNKNDYAWSMKEISWSLTNRRYTEKCVSYAESHDQAIVGDKTVAFLLMDEEMYSGMSSLVDASPIVERGIALQ
  KMIHFITMALGGEGYLNFMGNEFGHP
Full Sequence
Protein Sequence     Length: 899     Download
MINCLGLYPL ISAPSTIACT THIVRSKQYL ATQKPVNLAL GYRNPHGYGF SFGSRRSIHE    60
RVSSHFKGIA VMTDDKSTMS STEEDLENIG IFHIDPSLKP YKDHFKYRLK RYVDQKKLIE    120
EYEGGLEEFS QGYLKFGFNR EEGGIVYCEW APAAQEAQII GDFNGWDGSN HQMEKNQFGV    180
WSIRIPDTDG NSAIPHNSRV KFRFRHGDGV WVDRIPAWIK YATVDPTRFA APYDGVYWDP    240
PLSERYQFKY PRPPKPKAPR IYEAHVGMSS FEPRINSYRE FADEILPRIR ANNYNTVQLM    300
AVMEHSYYAS FGYHVTNFFA VSSRSGTPED LKYLIDKAHS LGLQVLMDVI HSHASNNVTD    360
GLNGFDVGQT SQDSYFHTGD RGYHKLWDSR LFNYANWEVL RFLLSNLRWW LEEFKFDGFR    420
FDGVTSMLYH HHGINIAFTG DYNEYFSEAT DVDAVVYLML ANCLIHSILP DATVIAEDVS    480
GMPGLGQPVS DGGIGFDYRL AMAIPDKWID YLKNKNDYAW SMKEISWSLT NRRYTEKCVS    540
YAESHDQAIV GDKTVAFLLM DEEMYSGMSS LVDASPIVER GIALQKMIHF ITMALGGEGY    600
LNFMGNEFGH PEWIDFPREG NGWSYEKCRR QWNLVDTDHL RYKFMNAFDR AMNLLDDKFS    660
FLASTKQIVS SADDDDKVIV FERGDLIFVF NFHPENTYEG YKVGCDLPGK YRVALDSDAW    720
EFGGRGRVGH DVDHFTSPEG IPGVPETNFN NRPNSFKVLS PARTCVAYYR VEESQEDDDN    780
NSLVGVEETS AAADVAKIPD ESASTESEDI KLDGVKETLA AADVAKIPDE SAPLESEDSN    840
LDVVKEPLAA ANAEVTKISG ELVSVETEGI NLDKLEETIV AASVESEVVR DKPEDAAN*     900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029602.0e-710818786+
PLN03244PLN032446.0e-133193731543+
PLN02447PLN02447069779711+
cd11321AmyAc_bac_euk_BE0243650408+
PLN02960PLN029600193769583+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT76445.1017281728starch branching enzyme I [Vigna radiata]
DDBJBAA82349.1018551847starch branching enzyme [Phaseolus vulgaris]
EMBLCAA54308.10183218341,4-alpha-glucan branching enzyme [Manihot esculenta]
EMBLCAA56320.10228638823starch branching enzyme II [Pisum sativum]
EMBLCBI18866.1018111821unnamed protein product [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3aml_A0798231751A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3amk_A0797771699A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B0797771699A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A0797771699A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB1m7x_D1.96182e-4414472426577A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO6191676931758630
HO794536721917990
HO7776386691437990
CX1091874423888230
HO77763847941400.021
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)