y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma04g07090.1
FamilyAA2
Protein PropertiesLength: 178 Molecular Weight: 19257.2 Isoelectric Point: 6.5186
ChromosomeChromosome/Scaffold: 04 Start: 5505356 End: 5506800
Descriptionascorbate peroxidase 6
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2141554.8e-31
  KGKAAGVLRLVFLDAGTFDIDDSTAKANGIWLSCKMKVNQLFEMVLQQAKTQIDVIQPNILLSVSWADMNIAVAGAEAVEVCGGPPIQVSPGRLDTLVHD
  PEGRLPEESLNASGLKKCFQSKGFLTQELVALSGAHTIGSKG
Full Sequence
Protein Sequence     Length: 178     Download
YLLIKEEVRK VLSKGKAAGV LRLVFLDAGT FDIDDSTAKA NGIWLSCKMK VNQLFEMVLQ    60
QAKTQIDVIQ PNILLSVSWA DMNIAVAGAE AVEVCGGPPI QVSPGRLDTL VHDPEGRLPE    120
ESLNASGLKK CFQSKGFLTQ ELVALSGAHT IGSKGFGSSI SFENSYYKVL LEKPWTSS      180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02608PLN026083.0e-1013150149+
cd00693secretory_peroxidase7.0e-124150166+
cd00314plant_peroxidase_like1.0e-1517177188+
pfam00141peroxidase5.0e-184150160+
cd00691ascorbate_peroxidase4.0e-194176198+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU18323.10117888263unknown [Glycine max]
RefSeqNP_194958.20117898273APX6; L-ascorbate peroxidase/ heme binding / peroxidase [Arabidopsis thaliana]
RefSeqXP_002282677.10117899274PREDICTED: similar to APX6 (ASCORBATE PEROXIDASE 6); L-ascorbate peroxidase [Vitis vinifera]
RefSeqXP_002309628.101178106281predicted protein [Populus trichocarpa]
RefSeqXP_002515511.10117897272L-ascorbate peroxidase 1, cytosolic, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1apx_D3e-17517119194A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB1apx_C3e-17517119194A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB1apx_B3e-17517119194A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB1apx_A3e-17517119194A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB3zch_A6e-16517131206A Chain A, Ascorbate Peroxidase W41a-h42m Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GW88465418211780
EV27564915411500
FG98709015411500
BG88266114961500
DW50303718211780
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00248.3Aquca_006_00248.2Aquca_046_00020.5Aquca_046_00020.4Aquca_046_00020.3
Aquca_046_00020.2Aquca_026_00111.1Aquca_027_00129.2Aquca_027_00129.1Aquca_046_00020.6
Aquca_006_00248.4Aquca_046_00020.1Aquca_046_00020.8Aquca_046_00020.7Aquca_026_00111.2
Aquca_014_00242.4Aquca_014_00242.3Aquca_014_00242.2Aquca_014_00242.1Aquca_006_00248.1
Aquca_014_00242.5Aquca_046_00020.9Aquca_006_00248.5Aquca_026_00111.3Aquca_020_00110.4
Aquca_020_00110.3Aquca_020_00110.2Aquca_020_00110.1
Arabidopsis lyrata899989491157899988478284491040
470824489749476914913218
Arabidopsis thalianaAT4G35000.1AT3G09640.2AT3G09640.1AT1G07890.8AT1G07890.7
AT1G07890.6AT1G07890.5AT1G07890.4AT1G07890.3AT1G07890.2
AT1G07890.1AT4G35970.1AT4G08390.3AT4G08390.2AT4G08390.1
AT1G77490.1AT4G08390.4AT4G32320.1
Brachypodium distachyonBradi5g03640.1Bradi3g42340.1Bradi5g03640.2Bradi1g65820.2Bradi1g16510.1
Bradi1g65820.3Bradi4g41180.1Bradi3g45700.1Bradi5g10490.3Bradi5g10490.1
Bradi3g40330.1
Brassica rapaBra017686Bra013053Bra018677Bra034076Bra030706
Bra031598Bra015668Bra037859Bra023954
Carica papayaevm.model.supercontig_6.282evm.TU.contig_30593.1evm.model.supercontig_139.46evm.model.supercontig_37.148
Capsella rubellaCarubv10005417mCarubv10016423mCarubv10014296mCarubv10009719mCarubv10014466m
Carubv10007422mCarubv10003730mCarubv10020327mCarubv10007089m
Chlamydomonas reinhardtiig10003.t1Cre02.g087700.t1.2Cre06.g285150.t1.2Cre01.g045700.t1.3
Citrus clementinaCiclev10028990mCiclev10026205mCiclev10029206mCiclev10012554mCiclev10030198m
Ciclev10029440mCiclev10029436mCiclev10001462mCiclev10001194mCiclev10008868m
Ciclev10009330m
Citrus sinensisorange1.1g023103morange1.1g024489morange1.1g026905morange1.1g025588morange1.1g026449m
orange1.1g025646morange1.1g025597morange1.1g025595morange1.1g025582morange1.1g025653m
orange1.1g024904morange1.1g024615morange1.1g029728morange1.1g024998morange1.1g029599m
orange1.1g031296morange1.1g031277morange1.1g028643morange1.1g027606morange1.1g028971m
orange1.1g016584morange1.1g016566morange1.1g016549morange1.1g016327morange1.1g013829m
orange1.1g026971morange1.1g030844morange1.1g029351morange1.1g027112morange1.1g030837m
orange1.1g029095morange1.1g027926morange1.1g019824morange1.1g032420morange1.1g030001m
orange1.1g020115morange1.1g026398m
Cucumis sativusCucsa.370590.5Cucsa.370590.2Cucsa.370590.1Cucsa.043770.1Cucsa.213340.2
Cucsa.213340.1Cucsa.043770.2Cucsa.370590.6Cucsa.051640.1Cucsa.060660.1
Cucsa.162470.1
Eucalyptus grandisEucgr.I01408.1Eucgr.J02463.1Eucgr.B02456.3Eucgr.B02456.2Eucgr.B02456.1
Eucgr.A01180.1Eucgr.J00965.2Eucgr.J00965.1Eucgr.J00965.3Eucgr.B02456.5
Eucgr.F04344.1Eucgr.F04344.2Eucgr.I01408.2Eucgr.B02456.4Eucgr.C01740.1
Eucgr.C01740.2
Fragaria vescamrna14580.1-v1.0-hybridmrna14579.1-v1.0-hybridmrna18099.1-v1.0-hybridmrna25391.1-v1.0-hybridmrna11214.1-v1.0-hybrid
mrna07647.1-v1.0-hybrid.21.142mrna07647.1-v1.0-hybrid.21.142mrna07647.1-v1.0-hybrid.207.314mrna07647.1-v1.0-hybrid.207.314mrna11632.1-v1.0-hybrid
Glycine maxGlyma12g03610.1Glyma11g11460.1Glyma11g08320.1Glyma11g15680.5Glyma12g07780.3
Glyma12g03610.2Glyma01g36940.1Glyma11g15680.3Glyma04g42720.6Glyma04g42720.5
Glyma04g42720.2Glyma04g42720.1Glyma06g12020.1Glyma11g15680.2Glyma06g12020.2
Glyma06g07180.1Glyma06g07180.2Glyma06g12020.5
Gossypium raimondiiGorai.005G254100.1Gorai.002G196800.1Gorai.003G008200.2Gorai.003G008200.1Gorai.009G420500.1
Gorai.005G254100.4Gorai.004G227100.5Gorai.004G227100.3Gorai.004G227100.2Gorai.004G227100.1
Gorai.004G227200.3Gorai.004G227200.2Gorai.004G227200.1Gorai.002G196800.3Gorai.004G227300.3
Gorai.004G227300.1Gorai.009G104500.4Gorai.009G104500.3Gorai.009G104500.2Gorai.009G104500.1
Gorai.009G104500.5Gorai.013G266100.1Gorai.004G227100.4Gorai.004G227300.4Gorai.009G104500.6
Gorai.005G254100.2Gorai.009G104500.9Gorai.009G104500.8Gorai.009G246900.6Gorai.009G246900.5
Gorai.009G246900.4Gorai.009G246900.2Gorai.009G246900.1Gorai.010G051400.2Gorai.010G051400.1
Gorai.002G196800.2Gorai.004G227300.5Gorai.004G227300.2Gorai.009G104500.10Gorai.009G104500.7
Gorai.005G254100.3.26.133Gorai.005G254100.3.26.133Gorai.009G104500.11Gorai.005G254100.3.134.226Gorai.005G254100.3.134.226
Gorai.009G246900.7Gorai.009G246900.3Gorai.010G115200.3Gorai.010G115200.2Gorai.004G227200.4
Gorai.004G227300.6Gorai.010G115200.1Gorai.010G115200.7Gorai.010G115200.6Gorai.010G115200.5
Gorai.010G115200.4Gorai.009G246900.8
Linum usitatissimumLus10014128Lus10019781Lus10015970Lus10013537Lus10019906
Lus10000180Lus10025680Lus10028432Lus10018155Lus10002916
Malus domesticaMDP0000151342MDP0000169497MDP0000234905MDP0000210077MDP0000199034
MDP0000241173MDP0000192572MDP0000021998MDP0000126107MDP0000248823
MDP0000399965MDP0000307661MDP0000918790MDP0000261341MDP0000943804
MDP0000254826
Manihot esculentacassava4.1_013189mcassava4.1_013184mcassava4.1_013404mcassava4.1_015356mcassava4.1_024509m
cassava4.1_014642mcassava4.1_014583mcassava4.1_014423mcassava4.1_014643mcassava4.1_013461m
cassava4.1_015710mcassava4.1_015013mcassava4.1_009867mcassava4.1_027175mcassava4.1_028424m
cassava4.1_015058mcassava4.1_031401mcassava4.1_018316mcassava4.1_015741m
Medicago truncatulaMedtr5g022510.1Medtr4g073410.1Medtr4g061140.1Medtr3g088160.3Medtr3g088160.2
Medtr3g088160.1Medtr3g107060.1Medtr5g008440.1
Mimulus guttatusmgv1a011241mmgv1a012445mmgv1a012581mmgv1a012424mmgv1a012401m
mgv1a012399mmgv1a012123mmgv1a008218mmgv1a008194mmgv1a006830m
mgv1a010472m
Oryza sativaLOC_Os04g14680.1LOC_Os08g43560.1LOC_Os03g17690.1LOC_Os08g43560.2LOC_Os07g49400.2
LOC_Os07g49400.1LOC_Os08g43560.3LOC_Os03g17690.2LOC_Os07g49400.3LOC_Os04g35520.4
LOC_Os04g35520.3LOC_Os04g35520.2LOC_Os04g35520.1LOC_Os02g34810.1LOC_Os12g07820.1
LOC_Os12g07830.1LOC_Os07g49400.4LOC_Os08g41090.1
Panicum virgatumPavirv00039524mPavirv00001506mPavirv00010262mPavirv00061650mPavirv00061649m
Pavirv00022559mPavirv00007331mPavirv00049678mPavirv00049677mPavirv00049676m
Pavirv00052189mPavirv00022560mPavirv00061651mPavirv00057923mPavirv00041376m
Pavirv00043064mPavirv00034381mPavirv00019577mPavirv00034191mPavirv00054025m
Pavirv00070703mPavirv00053973mPavirv00065497mPavirv00070704m
Physcomitrella patensPp1s21_105V6.7Pp1s21_105V6.6Pp1s21_105V6.5Pp1s21_105V6.4Pp1s21_105V6.3
Pp1s21_105V6.2Pp1s21_105V6.1Pp1s152_82V6.1Pp1s152_86V6.1Pp1s152_82V6.2
Pp1s152_86V6.2Pp1s424_33V6.1Pp1s277_34V6.1
Phaseolus vulgarisPhvul.011G035000.1Phvul.002G107000.1Phvul.011G071300.1Phvul.011G035000.2Phvul.009G126500.2
Phvul.009G126500.1Phvul.002G104700.1Phvul.009G093000.1
Picea abiesMA_79741g0010MA_110270g0010MA_177059g0010MA_119996g0010MA_20242g0010
MA_22175g0010MA_103975g0010MA_445446g0010MA_23907g0010
Populus trichocarpaPotri.009G134100.4Potri.009G134100.3Potri.009G134100.2Potri.009G134100.1Potri.005G112200.1
Potri.004G174500.1Potri.016G084800.1Potri.009G015400.9Potri.009G015400.8Potri.009G015400.11
Potri.009G015400.10Potri.006G132200.3Potri.016G084800.3Potri.006G132200.2Potri.009G015400.1
Potri.016G084800.5Potri.016G084800.4Potri.016G084800.2Potri.009G015400.2Potri.009G015400.6
Potri.009G015400.5Potri.009G015400.4Potri.006G132200.4Potri.005G179200.6Potri.005G179200.5
Potri.005G179200.4Potri.005G179200.3Potri.005G179200.2Potri.005G179200.1Potri.002G081900.1
Potri.009G015400.7Potri.006G132200.1Potri.009G015400.3Potri.002G081900.2Potri.009G015400.12
Potri.006G254500.1Potri.006G089000.1
Prunus persicappa009538mppa009582mppa010426mppa010431mppa010413m
ppa010673mppa006270mppa015878m
Ricinus communis29602.m00021729781.m00001329648.m00202429656.m00047729848.m004624
29805.m001492
Setaria italicaSi010452mSi014193mSi030912mSi037167mSi014221m
Si031017mSi031192mSi010652mSi010520mSi017077m
Si014042mSi014032m
Selaginella moellendorffii11903913933727017685469156990
74674169019
Sorghum bicolorSb06g001970.1Sb07g024880.1Sb02g044060.1Sb01g038760.1Sb08g004880.1
Sb06g017080.1Sb04g022560.1Sb07g027300.1
Thellungiella halophilaThhalv10025911mThhalv10022797mThhalv10021381mThhalv10025942mThhalv10008573m
Thhalv10023023mThhalv10008402mThhalv10028759mThhalv10018587mThhalv10018581m
Thhalv10025686mThhalv10018732m
Vitis viniferaGSVIVT01024035001GSVIVT01025551001GSVIVT01025104001GSVIVT01018740001GSVIVT01008846001
GSVIVT01035858001GSVIVT01018743001
Volvox carteriVocar20005261mVocar20010884mVocar20010184mVocar20006631mVocar20006630m.86.187
Vocar20006630m.86.187Vocar20006630m.472.696Vocar20006630m.472.696
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)