y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma04g09470.2
FamilyGT43
Protein PropertiesLength: 232 Molecular Weight: 26168.3 Isoelectric Point: 10.8876
ChromosomeChromosome/Scaffold: 04 Start: 7702662 End: 7705229
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT43932070
  RFGTWPVAMLAPSKNKAILEGPVCNASQVIGWHTNEKSKRLRRFHVDMSGFAFNSTILWDPKRWRRPSSNPVRQLDTVKEGFQETTFIEQLVEDESQMEG
  SPPGCSKILNWHLHL
Full Sequence
Protein Sequence     Length: 232     Download
MASFRRTLSP AYPDRQYLNG SFSVSSPSHK LPSSNAKYSS PLPELVAAFL RLAGGVFTRR    60
HGRKGQWRRV VVRCVLCFFV GFLLGMFPFG HVRFGTWPVA MLAPSKNKAI LEGPVCNASQ    120
VIGWHTNEKS KRLRRFHVDM SGFAFNSTIL WDPKRWRRPS SNPVRQLDTV KEGFQETTFI    180
EQLVEDESQM EGSPPGCSKI LNWHLHLAAN NIVYPKGWVL QKNLDAVIPV K*            240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02458PLN024584.0e-3494207120+
pfam03360Glyco_transf_431.0e-3793209117+
cd00218GlcAT-I5.0e-4593209117+
Gene Ontology
GO TermDescription
GO:0015018galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAI93173.17e-31192190beta-1,3-glucuronosyltransferase [Lotus japonicus]
EMBLCAI93173.1093231265403beta-1,3-glucuronosyltransferase [Lotus japonicus]
EMBLCAI93174.22e-34192191beta-1,3-glucuronosyltransferase [Medicago truncatula]
EMBLCAI93174.2093231303441beta-1,3-glucuronosyltransferase [Medicago truncatula]
EMBLCAN73652.1093231168306hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2d0j_D0.0000000593212126231A Chain A, Crystal Structure Of Human Glcat-S Apo Form
PDB2d0j_C0.0000000593212126231A Chain A, Crystal Structure Of Human Glcat-S Apo Form
PDB2d0j_B0.0000000593212126231A Chain A, Crystal Structure Of Human Glcat-S Apo Form
PDB2d0j_A0.0000000593212126231A Chain A, Crystal Structure Of Human Glcat-S Apo Form
PDB1v84_B0.00000593204132230A Chain A, Crystal Structure Of Human Glcat-S Apo Form
Transmembrane Domains
StartEnd
7092
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR466589140932320
CA921081140932320
CA921060140932320
HO786238140932320
DT033823140932320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00731.2Aquca_007_00731.1Aquca_001_00368.3Aquca_001_00368.2Aquca_001_00368.1
Aquca_010_00019.1Aquca_027_00094.1
Arabidopsis lyrata912627496876890287902844
Arabidopsis thalianaAT5G67230.1AT4G36890.1AT1G27600.2AT1G27600.1AT2G37090.1
Brachypodium distachyonBradi1g33320.3Bradi1g33320.2Bradi1g33320.1Bradi5g24290.1Bradi3g23120.1
Bradi2g00290.1Bradi5g02350.1Bradi2g46410.1Bradi2g16840.1Bradi1g16540.1
Bradi1g65750.1Bradi1g16540.2Bradi2g37970.3Bradi2g37970.1
Brassica rapaBra012145Bra011745Bra010929Bra030055Bra005218
Carica papayaevm.model.supercontig_55.103evm.model.supercontig_7.258evm.model.supercontig_366.2evm.model.supercontig_286.11
Capsella rubellaCarubv10004588mCarubv10027753mCarubv10009365mCarubv10025381mCarubv10025384m
Citrus clementinaCiclev10025401mCiclev10008306mCiclev10008305mCiclev10008303mCiclev10001397m
Ciclev10012036m
Citrus sinensisorange1.1g013985morange1.1g010452morange1.1g013438morange1.1g013414morange1.1g016070m
orange1.1g016052morange1.1g042066m
Cucumis sativusCucsa.102610.2Cucsa.102610.1Cucsa.312290.4Cucsa.312610.1Cucsa.312290.3
Cucsa.312290.2Cucsa.312290.1.175.269Cucsa.312290.1.175.269Cucsa.307090.2Cucsa.307090.1
Cucsa.312290.1.357.476Cucsa.312290.1.357.476
Eucalyptus grandisEucgr.I00880.2Eucgr.I00880.1Eucgr.H02219.1Eucgr.C00584.1Eucgr.F00463.3
Eucgr.F00463.2Eucgr.F00463.1Eucgr.F02177.3Eucgr.F02177.2Eucgr.F02177.1
Eucgr.A01172.1Eucgr.K03214.1
Fragaria vescamrna23860.1-v1.0-hybridmrna09635.1-v1.0-hybridmrna08813.1-v1.0-hybridmrna26845.1-v1.0-hybrid
Glycine maxGlyma17g18450.2Glyma17g18450.1Glyma16g16280.1Glyma11g05640.1Glyma01g39610.1
Glyma05g20910.2Glyma06g08820.1Glyma04g08720.2Glyma04g08720.1Glyma03g33570.1
Glyma19g36280.1Glyma10g05730.2Glyma10g05730.1Glyma13g20080.1Glyma13g20080.2
Glyma06g09560.1
Gossypium raimondiiGorai.007G216800.2Gorai.007G216800.1Gorai.003G026800.1Gorai.004G051000.1Gorai.004G051100.1
Gorai.004G290300.4Gorai.004G290300.3Gorai.004G290300.2Gorai.004G290300.1Gorai.009G051500.3
Gorai.009G051500.2Gorai.009G051500.1Gorai.005G097300.3Gorai.005G097300.2Gorai.005G097300.1
Gorai.002G137600.1Gorai.006G168500.1Gorai.010G031000.2Gorai.010G031000.1Gorai.006G168500.2
Linum usitatissimumLus10010268Lus10041601Lus10011500Lus10019325Lus10032817
Lus10007692Lus10019917Lus10026487Lus10015069
Malus domesticaMDP0000186002MDP0000308871MDP0000207693MDP0000287243MDP0000666177
MDP0000703247MDP0000259253MDP0000487987MDP0000131594MDP0000126039
MDP0000130817
Manihot esculentacassava4.1_006028mcassava4.1_006067mcassava4.1_008517mcassava4.1_007765mcassava4.1_008594m
cassava4.1_031170mcassava4.1_029083m
Medicago truncatulaMedtr5g016600.1AC225517_17.1Medtr3g111060.1Medtr7g100800.1
Mimulus guttatusmgv1a004664mmgv1a008341mmgv1a011740mmgv1a020319mmgv1a007326m
mgv1a007301mmgv1a010149mmgv1a009864m
Oryza sativaLOC_Os06g47340.1LOC_Os04g55670.1LOC_Os10g13810.1LOC_Os03g17850.1LOC_Os01g48440.1
LOC_Os01g48440.3LOC_Os01g48440.2LOC_Os05g48600.2LOC_Os05g48600.1LOC_Os01g06450.1
LOC_Os04g01280.1LOC_Os05g03174.2LOC_Os05g03174.1LOC_Os07g49370.1
Panicum virgatumPavirv00070690mPavirv00002442mPavirv00049605mPavirv00049604mPavirv00066013m
Pavirv00015553mPavirv00048742mPavirv00020159mPavirv00023302mPavirv00014028m
Pavirv00068635mPavirv00020160mPavirv00041023mPavirv00041022mPavirv00069320m
Pavirv00069319mPavirv00064679mPavirv00025005mPavirv00063696mPavirv00054446m
Pavirv00038884mPavirv00043409mPavirv00036401m
Physcomitrella patensPp1s248_13V6.1Pp1s78_128V6.1Pp1s19_221V6.1Pp1s1_540V6.1Pp1s52_108V6.1
Phaseolus vulgarisPhvul.002G016000.1Phvul.009G107900.2Phvul.009G107900.1Phvul.001G175200.1Phvul.007G164400.2
Phvul.009G146400.1Phvul.007G164400.1
Picea abiesMA_10433413g0010MA_9135945g0010MA_10426088g0010MA_42440g0010
Populus trichocarpaPotri.007G047500.2Potri.007G047500.1Potri.005G141500.1Potri.002G107300.3Potri.002G107300.2
Potri.002G107300.1Potri.006G240200.1Potri.006G240200.2Potri.006G131000.2Potri.006G131000.1
Potri.016G086400.1Potri.018G039900.1
Prunus persicappa004411mppa005926mppa006476mppa007640m
Ricinus communis29794.m00343730170.m01362129805.m001478
Setaria italicaSi006224mSi010088mSi002282mSi036401mSi001449m
Si022019mSi010329mSi010328mSi005128mSi030381m
Si022408m
Selaginella moellendorffii1208278265416278
Sorghum bicolorSb10g027970.1Sb06g030810.1Sb03g011010.1Sb09g028220.1Sb03g030990.1
Sb06g000430.1Sb01g038640.1Sb03g005410.1Sb09g002200.1Sb02g044020.1
Thellungiella halophilaThhalv10024924mThhalv10004084mThhalv10007547mThhalv10016877m
Vitis viniferaGSVIVT01022064001GSVIVT01035647001GSVIVT01025636001GSVIVT01009245001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)