y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma04g13613.1
FamilyCE8
Protein PropertiesLength: 217 Molecular Weight: 24481.1 Isoelectric Point: 10.4079
ChromosomeChromosome/Scaffold: 04 Start: 13295193 End: 13297960
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8252160
  VGSGNFKTVQDAVNAAAKRKLKMRFVIHVKKGVYRENIDVAVHNDNIMLVGDGLRNTITTSGRSFQDGYTTYSSATAGIDGLHFIARDITFQNIVGPHKG
  QVVALRSESDLFVFYRCAIIGYQDTFMAHAQRQFYRPCYIYGTMDFIFGNSAVVFQNCYIVARKPLDGQANMITAQGRGDPFQNTRISIHNS
Full Sequence
Protein Sequence     Length: 217     Download
MRKHGSTLLS RTFKRVLRHM LWWQVGSGNF KTVQDAVNAA AKRKLKMRFV IHVKKGVYRE    60
NIDVAVHNDN IMLVGDGLRN TITTSGRSFQ DGYTTYSSAT AGIDGLHFIA RDITFQNIVG    120
PHKGQVVALR SESDLFVFYR CAIIGYQDTF MAHAQRQFYR PCYIYGTMDF IFGNSAVVFQ    180
NCYIVARKPL DGQANMITAQ GRGDPFQNTR ISIHNS*                             240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02201PLN022017.0e-7926216191+
PLN02916PLN029165.0e-7924216195+
PLN02301PLN023011.0e-8326215190+
PLN02995PLN029952.0e-1027216215+
pfam01095Pectinesterase9.0e-10326216191+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_199962.107216205419pectinesterase family protein [Arabidopsis thaliana]
RefSeqNP_199963.107216207423pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002318284.1026216220410predicted protein [Populus trichocarpa]
RefSeqXP_002322402.1026216218408predicted protein [Populus trichocarpa]
RefSeqXP_002510939.1024216218410Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A02621615204A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A0242149198B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B0.00000000000023018718193B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A0.00000000000023018718193B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B0.00000000000023018718193B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA851330193242160
FG578767182362160
GO031971164151780
GT239390192242150
ES98055418131820
Orthologous Group
SpeciesID
Malus domesticaMDP0000226941MDP0000131899
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny