y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma04g32745.1
FamilyGH79
Protein PropertiesLength: 548 Molecular Weight: 61063.4 Isoelectric Point: 7.4776
ChromosomeChromosome/Scaffold: 04 Start: 37886310 End: 37892142
Descriptionglucuronidase 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH79405360
  DNFICATIDWWPHDKCDYNHCPWGYSSVVNLDLSHPFLAKAIQALRPLRIRLGGSLQDQVLYDVGSLKSPCHPLQKVKGGLFGFSKGCLHMKRWDELNQF
  FNETGAIVTFGLNALHGKHQISHNVWEGAWDPTNAYDFIEYTISKGYKIDSWELGNELSGKGIGASVGVAQYGKDLIKLKQILSTLYESSKFKPSLVAPG
  GFYEKHWYDRLLQVSGSGIINVLTHHLYNLGPGSDEHLERKILDPERLSRVESIFGNLSETIKIYGPWSSAWVGEAGGAYNSGGNHVSNRFLNSFWYLDQ
  LGIASCYSTKVYCRQTLIGGNYGLLNTTTFAPNPDYYSALLWHRLMGKKVLAVSSDVSSPFLRTYAHCTKDRAGVTLLLINLSNQTDFILTVRNPVTASV
  VENEVATSTHKESSFFDKLKKTFSWVGTKGSEVTFREEYHLTPKDGYLRSQTMVLNGIPLELTDEGDLPPLDPVRNNVRSPIYMTPLSIAFVVYPNF
Full Sequence
Protein Sequence     Length: 548     Download
MRFHLALFLF LASLQATLSQ DIEHGSLLVD GAQTKAETGD NFICATIDWW PHDKCDYNHC    60
PWGYSSVVNL DLSHPFLAKA IQALRPLRIR LGGSLQDQVL YDVGSLKSPC HPLQKVKGGL    120
FGFSKGCLHM KRWDELNQFF NETGAIVTFG LNALHGKHQI SHNVWEGAWD PTNAYDFIEY    180
TISKGYKIDS WELGNELSGK GIGASVGVAQ YGKDLIKLKQ ILSTLYESSK FKPSLVAPGG    240
FYEKHWYDRL LQVSGSGIIN VLTHHLYNLG PGSDEHLERK ILDPERLSRV ESIFGNLSET    300
IKIYGPWSSA WVGEAGGAYN SGGNHVSNRF LNSFWYLDQL GIASCYSTKV YCRQTLIGGN    360
YGLLNTTTFA PNPDYYSALL WHRLMGKKVL AVSSDVSSPF LRTYAHCTKD RAGVTLLLIN    420
LSNQTDFILT VRNPVTASVV ENEVATSTHK ESSFFDKLKK TFSWVGTKGS EVTFREEYHL    480
TPKDGYLRSQ TMVLNGIPLE LTDEGDLPPL DPVRNNVRSP IYMTPLSIAF VVYPNFDAPA    540
CATHRKL*                                                             600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03662Glyco_hydro_79n023341319+
Gene Ontology
GO TermDescription
GO:0016020membrane
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI15157.101254212513unnamed protein product [Vitis vinifera]
RefSeqNP_196400.2065427543AtGUS2 (Arabidopsis thaliana glucuronidase 2); beta-glucuronidase
RefSeqXP_002284470.101254212539PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321464.1015421541predicted protein [Populus trichocarpa]
RefSeqXP_002514696.101854218539Heparanase-2, putative [Ricinus communis]
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7970313751725460
HO7815483472005460
FK0002052522815320
CF8077082442805230
FG9888052263235480
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00009.1Aquca_002_00770.2Aquca_002_00771.1Aquca_002_00770.1Aquca_002_00770.3
Aquca_002_00771.4Aquca_002_00771.3Aquca_002_00770.4Aquca_002_00771.2.202.436Aquca_002_00771.2.202.436
Aquca_002_00771.2.40.206Aquca_002_00771.2.40.206
Arabidopsis lyrata493582496280350042497509
Arabidopsis thalianaAT5G34940.2AT5G07830.1AT5G61250.2AT5G61250.1AT5G34940.3
AT5G34940.1
Brachypodium distachyonBradi1g47760.1Bradi3g54370.1Bradi1g70300.1Bradi4g03680.1Bradi4g03680.2
Bradi1g70300.3
Brassica rapaBra038945Bra012974Bra009310
Carica papayaevm.model.supercontig_277.3evm.model.supercontig_187.5evm.model.supercontig_51.106evm.model.supercontig_51.104evm.model.supercontig_51.103
Capsella rubellaCarubv10004531mCarubv10028123mCarubv10002679m
Citrus clementinaCiclev10007919mCiclev10010401mCiclev10019606mCiclev10019304mCiclev10033641m
Citrus sinensisorange1.1g008951morange1.1g037212morange1.1g008762morange1.1g009131morange1.1g009122m
orange1.1g009113morange1.1g009102morange1.1g008834morange1.1g041499morange1.1g013838m
orange1.1g014399morange1.1g019695m
Cucumis sativusCucsa.113020.5Cucsa.113020.2Cucsa.113020.1Cucsa.132500.1Cucsa.198040.1
Cucsa.284640.1Cucsa.201230.1Cucsa.034470.1Cucsa.252720.2Cucsa.252720.1
Eucalyptus grandisEucgr.C02742.1Eucgr.K02497.1Eucgr.B00567.2Eucgr.B00567.1Eucgr.G02460.1
Eucgr.C04395.1Eucgr.B03174.1Eucgr.C02742.2Eucgr.C04395.2Eucgr.C02741.1
Eucgr.C02740.1
Fragaria vescamrna30784.1-v1.0-hybridmrna26075.1-v1.0-hybridmrna11598.1-v1.0-hybridmrna11600.1-v1.0-hybrid
Glycine maxGlyma09g11990.2Glyma09g11990.1Glyma15g23550.1Glyma13g23190.1Glyma17g11670.1
Glyma04g32745.2Glyma05g00663.1Glyma17g08444.1Glyma06g21551.2Glyma06g21551.1
Glyma02g12760.1Glyma02g12740.1Glyma09g11990.3Glyma05g00663.2Glyma02g12740.2
Glyma06g40075.1Glyma10g27494.1
Gossypium raimondiiGorai.004G108900.2Gorai.004G108900.1Gorai.008G196400.1Gorai.010G059600.1Gorai.006G267500.2
Gorai.006G267500.1Gorai.004G293000.2Gorai.011G285000.1Gorai.011G271100.1Gorai.004G293000.1
Gorai.N016700.1Gorai.011G285200.1Gorai.N009300.1Gorai.010G059600.2Gorai.006G004300.1
Gorai.009G305800.1Gorai.008G196400.2Gorai.006G004400.1Gorai.N021000.1Gorai.006G004500.1
Gorai.010G059600.3Gorai.N009100.1Gorai.006G004200.1Gorai.N009200.1.197.494Gorai.N009200.1.197.494
Gorai.011G284500.1.38.235Gorai.011G284500.1.38.235Gorai.006G021700.1.57.271Gorai.006G021700.1.57.271Gorai.011G284500.1.237.471
Gorai.011G284500.1.237.471Gorai.N009200.1.41.200Gorai.N009200.1.41.200Gorai.011G271700.1Gorai.006G021700.1.269.391
Gorai.006G021700.1.269.391
Linum usitatissimumLus10008823Lus10038109Lus10008038Lus10003468Lus10015737
Lus10021652Lus10034707Lus10001923Lus10004664Lus10036963
Lus10037110Lus10037109Lus10036962Lus10001952
Malus domesticaMDP0000088659MDP0000189628MDP0000242071MDP0000199066MDP0000252327
MDP0000248683
Manihot esculentacassava4.1_032464mcassava4.1_005011mcassava4.1_031502mcassava4.1_005078mcassava4.1_005072m
cassava4.1_004963mcassava4.1_021602mcassava4.1_008768m
Medicago truncatulaMedtr4g116070.1Medtr5g043710.1Medtr4g116040.1Medtr8g091920.1
Mimulus guttatusmgv1a026019mmgv1a004063mmgv1a026758mmgv1a004017mmgv1a004194m
mgv1a008019mmgv1a008017mmgv1a025097mmgv1a011158m
Oryza sativaLOC_Os06g08090.2LOC_Os06g08090.1LOC_Os02g55870.1LOC_Os12g38920.2LOC_Os12g38920.1
LOC_Os03g11320.2LOC_Os03g11320.1LOC_Os07g40740.1
Panicum virgatumPavirv00018673mPavirv00048771mPavirv00008589mPavirv00009033mPavirv00009032m
Pavirv00012019mPavirv00030038mPavirv00060468mPavirv00035109mPavirv00018674m
Pavirv00033639m
Physcomitrella patensPp1s118_67V6.1Pp1s90_137V6.1Pp1s121_77V6.1Pp1s181_80V6.1
Phaseolus vulgarisPhvul.009G212400.1Phvul.003G186600.2Phvul.003G186600.1Phvul.003G171800.1Phvul.002G081000.1
Phvul.003G171800.2Phvul.002G087100.3Phvul.002G087100.2Phvul.002G087100.1
Picea abiesMA_77698g0010MA_10433885g0020MA_93036g0020MA_854085g0010MA_71853g0010
MA_93036g0010.60.248MA_93036g0010.60.248MA_343625g0010MA_269826g0010MA_10433885g0010
MA_93036g0010.317.479MA_93036g0010.317.479
Populus trichocarpaPotri.018G121500.1Potri.018G024200.1Potri.006G062200.2Potri.006G062200.1Potri.010G160800.2
Potri.010G160800.1Potri.010G160800.3Potri.015G049100.4Potri.015G049100.3Potri.015G049100.2
Potri.015G049100.1Potri.018G121500.3Potri.018G121500.2Potri.015G049100.5Potri.010G160800.4
Potri.015G049100.6
Prunus persicappa003883mppa019445mppa003804mppa003813mppa025624m
Ricinus communis29848.m00459029720.m00013730138.m00401530174.m00914230174.m009143
Setaria italicaSi016855mSi006147mSi035072mSi035071mSi021698m
Selaginella moellendorffii10593113310032458
Sorghum bicolorSb04g036200.1Sb10g005260.1Sb01g043180.1Sb08g019250.1
Thellungiella halophilaThhalv10013186mThhalv10003960mThhalv10003449m
Vitis viniferaGSVIVT01012851001GSVIVT01007918001GSVIVT01012184001GSVIVT01035950001.36.452GSVIVT01035950001.36.452
GSVIVT01035950001.521.878GSVIVT01035950001.521.878
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)