y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma04g38580.3
FamilyGH35
Protein PropertiesLength: 693 Molecular Weight: 78364.5 Isoelectric Point: 6.1641
ChromosomeChromosome/Scaffold: 04 Start: 44945487 End: 44955992
DescriptionGlycosyl hydrolase family 35 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35293130
  IKQMWPDLIAKAKQGGLDVIQTYVFWNLHEPQPGMYDFRGRYDLVGFIKEIQAQGLYVCLRIGPFIQSEWKYGGFPFWLHDVPGIVYRTDNESFKFYMQN
  FTTKIVNMMKEEGLYASQGGPIILSQIENEYQNIQKAFGTAGSQYVQWAAKMAVGLNTGVPWVMCKQTDAPDPVINTCNGMRCGETFTGPNSPNKPALWT
  ENWTSFYQVYGGLPYIRSAEDIAFHVTLFIARNGSYVNYYMYHGGTNFGRTASAYVITGYYDQAPLDEYGLLRQPKWGHLKQLHE
Full Sequence
Protein Sequence     Length: 693     Download
MQSLLNRRTK PLTVANSLLH HGYECAYMIK QMWPDLIAKA KQGGLDVIQT YVFWNLHEPQ    60
PGMYDFRGRY DLVGFIKEIQ AQGLYVCLRI GPFIQSEWKY GGFPFWLHDV PGIVYRTDNE    120
SFKFYMQNFT TKIVNMMKEE GLYASQGGPI ILSQIENEYQ NIQKAFGTAG SQYVQWAAKM    180
AVGLNTGVPW VMCKQTDAPD PVINTCNGMR CGETFTGPNS PNKPALWTEN WTSFYQVYGG    240
LPYIRSAEDI AFHVTLFIAR NGSYVNYYMY HGGTNFGRTA SAYVITGYYD QAPLDEYGLL    300
RQPKWGHLKQ LHEVIKSCST TLLQGVQRNF SLGQLQEGYV FEEEKGECVA FLKNNDRDNK    360
VTVQFRNRSY ELLPRSISIL PDCQNVAFNT ANVNTTSNRR IISPKQNFSS LDDWKQFQDV    420
IPYFDNTSLR SDSLLEQMNT TKDKSDYLWY TLRFEYNLSC RKPTLSVQSA AHVAHAFINN    480
TYIGGEHGNH DVKSFTLELP VTVNQGTNNL SILSAMVGLP DSGAFLERRF AGLISVELQC    540
SEQESLNLTN STWGYQVGLL GEQLQVYKKQ NNSDIGWSQL GNIMEQLLIW YKTTFDTPEG    600
DDPVVLDLSS MGKGEAWVNE QSIGRYWILF HDSKGNPSQS LYHVPRSFLK DTGNVLVLVE    660
EGGGNPLGIS LDTVSVIDLQ QNFSKLTLPS SS*                                 720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13364BetaGal_dom4_50.00242652097+
pfam02449Glyco_hydro_421.0e-533166157+
COG1874LacA1.0e-1432291302+
pfam01301Glyco_hydro_357.0e-13630312297+
PLN03059PLN03059031650651+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF01618.103168761718beta-galactosidase like protein [Arabidopsis thaliana]
EMBLCAN82672.103167955676hypothetical protein [Vitis vinifera]
EMBLCBI21611.103168955720unnamed protein product [Vitis vinifera]
RefSeqXP_002274012.103168991749PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002307056.103168954714predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A9e-341031120325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3d3a_A0.0007441681374593A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D4e-253333542354A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C4e-253333542354A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_B4e-253333542354A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160651316520
HO780602587526270
HO795552550736100
HO7955524053920.000000000000006
HO7955522331530.000000000000006
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2Glyma08g00470.2
Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2Glyma12g03650.1
Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)