y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma04g39120.1
FamilyGT48
Protein PropertiesLength: 1900 Molecular Weight: 218181 Isoelectric Point: 9.2263
ChromosomeChromosome/Scaffold: 04 Start: 45355910 End: 45370890
Descriptioncallose synthase 5
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48102117600
  VPTNLEARRRIAFFTNSLFMDMPRAPRVRKMLSFSVLTPYYSEETVYSKNDLEVENEDGVSIIYYLQKIYPDEWTNFMERLECKKDSEIWEKDEHILQLR
  HWASLRGQTLSRTVRGMMYYRRAIKLQAFLDMANEQEILDGYKAVTVPSEEDKKSHRSLYASLEAVADMKFTYVATCQNYGNQKRSGDRRATDILNLMVN
  NPSLRVAYIDEIEEREGGKVQKVYYSVLVKAVDNLDQEIFRIKLPGPAKIGEGKPENQNHAIIFTRGEALQTIDMNQDNYLEEAFKMRNLLEEFNEDHGV
  RRPTILGVREHIFTGSVSSLAWFMSNQETSFVTIGQRVLARPLKVRFHYGHPDVFDRIFHITRGGISKASCGINLSEDIFAGFNSTLRRGNITHHEYIQC
  GKGRDVGLNQISLFEAKVACGNGEQTLSRDIYRLGHRFDFFRMLSCYFTTIGFYISSVIVVLTCYAFLYGKLYLSLSGFEAAIVKLARRKGDDALKAALT
  SQSLVQLGLIMTLPMFMEIGLERGFRTAIGELIIMQLQLAPVFFTFSLGTKLHYFGRTLLHGGAKYRATGRGFVVRHEKFAENYRMYSRSHFVKGIELTI
  LLLCYKIYGSATPDSTSYGFLSWSMWFMVCSFLFSPFLFNPSGFEWQKIVEDWDDWQKWISIRGGIGVPSNKSWESWWNEEQEHLQHTGFLGRICEIILD
  LRFFVYQYGIVYHLNVARGDKSILVYALSWIVIVAVMVIL
Full Sequence
Protein Sequence     Length: 1900     Download
MSFLEAAPHT LTRRPSRSAA TTFSTEVFDN DVVPSSLASI SPILRVANEI ESERPRVAYL    60
CRFYAFEKAH RLDQSSSGRG VRQFKTLLLQ RLERDNGPSL AGRLKKTDAR EIQAYYQQYY    120
EHYVRALDQG EQADRAQLGK AYQTAGVLFE VLCAVNKTEK VEEVAPEIIA AARDVQEKTE    180
IYAPFNILPL DSAGASQSIM QLEEIKASVS ALWNTRGLNW PTSFEQQRQR TGELDLLDWL    240
RAMFGFQRDN VRNQREHLIL LLANSHIRLN PKPEPLNKLD DRAVDAVMNS LFKNYKTWCK    300
FLGRKHSLRL PPGQQEIQQR KLLYMGLYLL IWGEASNVRF MPECLCYIFH NMAYELHGLL    360
AGNVSIVTGE NIKPSYGGDD EAFLRKVITP IYRVIETEAK KSRHGAAPHS AWCNYDDLNE    420
YFWSPDCFSL GWPMRDDGEF FRSTFNLTQG RKGSQKTSGR TVKSNFVETR SFWNIFRSFD    480
RLWTFYILGL QVLLIVAWKG ISVLDIFQKD VLYDLSSIFI TAAILRLLQS ILDLALNFPG    540
YHGWRFTDVL RNFLKVIVSL FWVVALPLFY VHSFKGAPDF IKDMLSFTDK IKGIPPLYML    600
AVAVYLLPNL LAAILFLFPM LRRWIENSDW HIIRLLLWWS QPRIYVGRGM HENQFALLKY    660
TLFWVILLAA KFSFSFFVQI KPLVQPTKDI MSIRHVDFGW HEFFPKARHN YGAVVALWAP    720
VLMVYFMDTQ IWYSIFSTIC GGVIGAFDRL GEIRTLTMLR SRFQSLPGAF NTYLVPTDKK    780
REKRFTFSKR FAEISASRRS EAAKFAQLWN EMDLLMVPYS SDPSLKIIQW PPFLLASKIP    840
IALDMAAQFR GKDSDLWRRI CADEYMKCAV IECYESFKNV LNALVVGEAE KRTISVIIKE    900
VENSISKNTL VANFRMGFLP SLCKKFVELV EILKDADSSK QGTVVVLLQD MLEVFTRDMV    960
VNEISELAEL NHSSKDTGRQ LFAGTDAKPA VLFPPLVTAQ WEEQIRRLHL LLTVKESAIE    1020
VPTNLEARRR IAFFTNSLFM DMPRAPRVRK MLSFSVLTPY YSEETVYSKN DLEVENEDGV    1080
SIIYYLQKIY PDEWTNFMER LECKKDSEIW EKDEHILQLR HWASLRGQTL SRTVRGMMYY    1140
RRAIKLQAFL DMANEQEILD GYKAVTVPSE EDKKSHRSLY ASLEAVADMK FTYVATCQNY    1200
GNQKRSGDRR ATDILNLMVN NPSLRVAYID EIEEREGGKV QKVYYSVLVK AVDNLDQEIF    1260
RIKLPGPAKI GEGKPENQNH AIIFTRGEAL QTIDMNQDNY LEEAFKMRNL LEEFNEDHGV    1320
RRPTILGVRE HIFTGSVSSL AWFMSNQETS FVTIGQRVLA RPLKVRFHYG HPDVFDRIFH    1380
ITRGGISKAS CGINLSEDIF AGFNSTLRRG NITHHEYIQC GKGRDVGLNQ ISLFEAKVAC    1440
GNGEQTLSRD IYRLGHRFDF FRMLSCYFTT IGFYISSVIV VLTCYAFLYG KLYLSLSGFE    1500
AAIVKLARRK GDDALKAALT SQSLVQLGLI MTLPMFMEIG LERGFRTAIG ELIIMQLQLA    1560
PVFFTFSLGT KLHYFGRTLL HGGAKYRATG RGFVVRHEKF AENYRMYSRS HFVKGIELTI    1620
LLLCYKIYGS ATPDSTSYGF LSWSMWFMVC SFLFSPFLFN PSGFEWQKIV EDWDDWQKWI    1680
SIRGGIGVPS NKSWESWWNE EQEHLQHTGF LGRICEIILD LRFFVYQYGI VYHLNVARGD    1740
KSILVYALSW IVIVAVMVIL KIVSMGRKQF SADFQLMFRL LKLFLFIGAI VALGLMFTLL    1800
SLTVGDIFAS LLAFLPTAWA VIQIGQACRP FVKGIGMWGS VKALARGYEY LMGVVIFAPV    1860
AILAWFPFVS EFQTRLLFNQ AFSRGLQIQR ILAGGKKNK*                          1920
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10459PRK104590.000517441866136+
pfam04652DUF6052.0e-1338152118+
pfam14288FKS1_dom14.0e-57319435118+
pfam02364Glucan_synthase010211760833+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK49452.2061899211931AF304372_1 putative beta-1,3-glucan synthase [Nicotiana alata]
GenBankACV04900.105189991923callose synthase 5 [Arabidopsis thaliana]
EMBLCAN80181.1011189931933hypothetical protein [Vitis vinifera]
RefSeqNP_849953.205189991923CALS5 (CALLOSE SYNTHASE 5); 1,3-beta-glucan synthase [Arabidopsis thaliana]
RefSeqXP_002274337.101189911918PREDICTED: hypothetical protein [Vitis vinifera]
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
482504
552574
596618
656678
707726
731753
14671489
15151537
15471569
16371659
17431765
17781800
18041826
18471869
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO780496341133016700
HO780496193166818590
HO780496133121113290
HO425519627127618970
HO780746521104615560
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma13g37290.2
Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3Glyma18g12870.2
Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1Glyma15g42330.4
Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1Glyma08g47670.2
Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6Glyma18g13105.10
Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5Glyma18g13105.4
Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5Glyma08g42110.1
Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4Glyma10g44150.2
Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)