y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma04g39641.1
FamilyGH17
Protein PropertiesLength: 282 Molecular Weight: 31840 Isoelectric Point: 5.1815
ChromosomeChromosome/Scaffold: 04 Start: 45837310 End: 45838258
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1741770
  VYESASDKSSDGDFRRDIRDAIKQILSLILERNSPFLVNIYPFLSLNQNTYFPEEFAFFDGQGRIIQDKDAQYSNVYDANLDTLVWSLKKAVVGEIGWPT
  DGNKNANNNNAKRFYQGILKKMAHKKGTPLHPGAMDIYLFSLTDENLKSIEPGNFERHWEIFRYDGRPKFPIDF
Full Sequence
Protein Sequence     Length: 282     Download
MPDVYESASD KSSDGDFRRD IRDAIKQILS LILERNSPFL VNIYPFLSLN QNTYFPEEFA    60
FFDGQGRIIQ DKDAQYSNVY DANLDTLVWS LKKAVVGEIG WPTDGNKNAN NNNAKRFYQG    120
ILKKMAHKKG TPLHPGAMDI YLFSLTDENL KSIEPGNFER HWEIFRYDGR PKFPIDFSGQ    180
GQDKWPVAAK GVVYQERFGC SCEKLDLAGN ASFAFNQYFQ TRDQSVEACD FNGMATIVKQ    240
DPSKGSCLFP IEIQSSGEML RAMCTIGSLF IGLPLFFITF T*                       300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X84.0e-719323644+
smart00768X87.0e-1818424985+
pfam00332Glyco_hydro_172.0e-3013177174+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN62816.103260164461hypothetical protein [Vitis vinifera]
EMBLCBI21529.103273164431unnamed protein product [Vitis vinifera]
RefSeqXP_002275701.103260164461PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310612.103280170484predicted protein [Populus trichocarpa]
RefSeqXP_002530257.103258168460Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ur8_B2e-2214178148315A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB3ur8_A2e-2214178148315A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB3ur7_B2e-2214178148315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3ur7_A2e-2214178148315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB4gzj_A1e-2114178148315A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Transmembrane Domains
StartEnd
258280
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO0293101991162820
EX34314228832490
DV70906829232530
DV70802729132520
DV71030428832490
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00224.1.20.338Aquca_003_00745.1.28.346Aquca_020_00610.1.27.345Aquca_114_00021.1.34.354Aquca_007_00315.1.61.381
Aquca_004_00628.1.27.348Aquca_009_00540.1.25.343Aquca_008_00064.1Aquca_004_00629.1.24.345Aquca_018_00224.2.20.308
Aquca_004_00435.1.27.350Aquca_114_00009.1
Arabidopsis lyrata495914.22.340913356.27.345329810.26.339910127.31.355862228.32.348
893776.25.343340560.33.352496695.29.347919046.27.345
Arabidopsis thalianaAT5G58090.1.22.340AT4G31140.1.27.345AT4G17180.1.25.338AT5G20870.1.31.355AT3G24330.1.39.359
AT2G19440.1.21.339AT5G18220.1.30.346AT3G04010.1.33.352AT1G64760.2.25.343AT1G64760.1.25.343
AT5G64790.1.29.347AT5G58480.1.26.345
Brachypodium distachyonBradi3g03520.1.32.349Bradi3g18220.1.26.345Bradi1g06050.1.30.349Bradi1g13232.1.30.352Bradi2g18420.1.29.348
Bradi1g56270.1.27.351Bradi1g60410.1.24.345Bradi1g37160.1.30.345Bradi4g15460.1.20.348Bradi2g18700.1.33.350
Bradi1g65197.1.33.352
Brassica rapaBra002673.24.342Bra020389.22.340Bra011249.27.345Bra024022.27.345Bra015034.37.357
Bra026232.23.336Bra006581.31.356Bra020132.27.352Bra036718.25.343Bra031954.33.351
Bra002143.32.350Bra037795.29.347Bra031901.29.347Bra002646.29.348
Carica papayaevm.model.supercontig_91.73.20.338evm.model.supercontig_82.42.24.342evm.model.supercontig_148.14.25.343evm.model.supercontig_23.144.10.347evm.model.supercontig_51.93.32.338
evm.model.supercontig_245.5evm.model.supercontig_2.378
Capsella rubellaCarubv10026324m.22.340Carubv10004695m.27.345Carubv10000767m.31.356Carubv10006187m.26.339Carubv10015679m.37.357
Carubv10003257m.30.346Carubv10013602m.21.339Carubv10013538m.33.352Carubv10027803m.29.347
Citrus clementinaCiclev10008079m.44.362Ciclev10014935m.66.384Ciclev10007363m.506.826Ciclev10008127m.27.344Ciclev10019922m.23.343
Ciclev10023781m.24.346Ciclev10027573mCiclev10027796m.24.348
Citrus sinensisorange1.1g011636m.25.343orange1.1g010789m.44.362orange1.1g010142m.66.384orange1.1g047337m.30.350orange1.1g011391m.27.344
orange1.1g011532m.23.343orange1.1g048257m.24.346orange1.1g045344m.183.501orange1.1g011468m.24.348
Cucumis sativusCucsa.356270.1.32.350Cucsa.310710.1.29.347Cucsa.319480.1.27.345Cucsa.340580.1.23.344Cucsa.101480.1.29.348
Cucsa.367020.1.30.349Cucsa.356270.2.30.259Cucsa.139490.1.29.352
Eucalyptus grandisEucgr.C02156.3.24.341Eucgr.C02156.2.24.341Eucgr.C02156.1.24.341Eucgr.C02145.1.29.347Eucgr.D00955.1.28.346
Eucgr.K01479.1.28.346Eucgr.A02084.1.25.343Eucgr.C04137.1.99.419Eucgr.I00311.1.25.344Eucgr.J01882.1.33.357
Fragaria vescamrna12970.1-v1.0-hybrid.28.344mrna21072.1-v1.0-hybrid.29.350mrna15460.1-v1.0-hybrid.24.342mrna19854.1-v1.0-hybrid.25.343mrna02065.1-v1.0-hybrid.31.350
mrna21133.1-v1.0-hybrid.25.344mrna21134.1-v1.0-hybrid.26.328
Glycine maxGlyma17g29760.1.29.343Glyma14g16830.1.29.346Glyma04g07820.2.31.349Glyma06g07890.1.24.342Glyma16g26860.1.28.347
Glyma16g04680.1.23.342Glyma13g17600.1.30.346Glyma17g04900.1.30.346Glyma15g12850.2.34.353Glyma15g12850.1.29.348
Glyma09g01910.2.26.345Glyma07g39950.1.26.344Glyma04g22190.1.44.364Glyma06g23474.1.26.344Glyma05g31860.1.27.346
Glyma17g12985.1.539.841Glyma06g15240.2.32.353Glyma18g06570.1.27.349Glyma11g29410.1.29.351Glyma19g28600.2
Gossypium raimondiiGorai.012G009200.1.27.345Gorai.004G097500.1.23.341Gorai.013G221700.1.25.342Gorai.007G287700.1.27.345Gorai.012G043900.1.46.364
Gorai.013G202800.1.28.346Gorai.010G094500.1.28.345Gorai.010G068800.1.529.849Gorai.008G101400.1.23.340Gorai.011G114400.1.25.345
Gorai.013G270800.1.23.346Gorai.011G114500.1.25.345Gorai.011G114600.1.25.345
Linum usitatissimumLus10001183.33.350Lus10043075.33.350Lus10031098.27.348Lus10024535.28.349Lus10039095.29.348
Lus10002633.26.346Lus10020261.21.341Lus10006811.52.373Lus10005788.52.373Lus10042269.27.352
Lus10017740.38.373Lus10026387.52.308
Malus domesticaMDP0000228162.40.358MDP0000195046.29.347MDP0000139990.29.347MDP0000233076MDP0000247204.29.347
MDP0000785544.23.344MDP0000547069.26.347MDP0000201986.31.348MDP0000295938.29.335MDP0000180536.29.348
MDP0000893827.24.340MDP0000896503.24.342MDP0000501865.24.342MDP0000245023.15.332MDP0000159387.25.342
MDP0000716700.22.346MDP0000276748.22.346MDP0000303770.29.310MDP0000254562.22.378MDP0000244261
MDP0000929496MDP0000585901MDP0000631128MDP0000265431MDP0000587047
Manihot esculentacassava4.1_006628m.23.341cassava4.1_006416m.27.345cassava4.1_006682m.26.344cassava4.1_006647m.26.344cassava4.1_006709m.19.339
cassava4.1_006673m.26.344cassava4.1_006689m.23.345cassava4.1_027475m.30.350cassava4.1_006515m.25.348
Medicago truncatulaMedtr6g032820.1.18.339Medtr7g085390.1.26.345Medtr4g124440.1.30.346Medtr2g027560.1.28.348Medtr3g108600.1.30.329
AC233669_25.1.33.351Medtr8g092070.1.34.353Medtr3g095050.1.34.351Medtr3g031770.1.27.343
Mimulus guttatusmgv1a027166m.27.345mgv1a004426m.71.389mgv1a004416m.72.390mgv1a005395m.31.349mgv1a022774m.20.342
mgv1a005003mmgv1a005260m.27.344mgv1a025912m.21.339mgv1a024281m
Oryza sativaLOC_Os02g04670.1.32.349LOC_Os08g12800.1.29.346LOC_Os07g07340.1.25.342LOC_Os08g23720.1.36.355LOC_Os06g39060.1.33.348
LOC_Os09g09980.1.25.344LOC_Os03g57880.3.34.354LOC_Os03g57880.2.34.354LOC_Os03g57880.1.34.354LOC_Os03g27980.1.30.352
LOC_Os03g45390.1.27.348LOC_Os11g36940.1.27.349LOC_Os03g18520.1.35.354
Panicum virgatumPavirv00039130m.30.348Pavirv00060764m.30.347Pavirv00046422m.31.351Pavirv00052629m.30.345Pavirv00024615m.27.346
Pavirv00016958m.30.343Pavirv00009799m.31.350Pavirv00058995m.31.350Pavirv00068552mPavirv00065383m
Pavirv00040364m.68.386Pavirv00046668m.29.335
Physcomitrella patensPp1s197_52V6.1.35.352Pp1s14_30V6.1.35.352Pp1s157_11V6.1.25.341Pp1s27_327V6.1.28.346Pp1s54_130V6.1.38.355
Pp1s162_17V6.2.27.345Pp1s162_17V6.1.27.345Pp1s109_183V6.2
Phaseolus vulgarisPhvul.001G057100.1.29.346Phvul.001G109400.1.23.342Phvul.003G126100.1.30.346Phvul.004G079100.1.25.344Phvul.006G135700.1.27.346
Phvul.003G088600.1.29.347Phvul.003G176600.1.554.874Phvul.009G200400.1.26.346Phvul.002G266100.1.62.380Phvul.009G138800.1.34.355
Phvul.006G072800.1.26.348Phvul.001G057100.2.27.259
Picea abiesMA_43291g0010.25.345MA_10437110g0020.25.346
Populus trichocarpaPotri.018G150400.1.23.342Potri.006G080600.2.23.342Potri.006G080600.1.23.342Potri.006G280700.1.38.356Potri.018G000900.1.42.360
Potri.018G077000.1.29.350Potri.018G072300.1.29.350Potri.016G002800.3.29.347Potri.016G002800.2.29.347Potri.016G002800.1.29.347
Potri.006G002100.1.29.347Potri.006G216700.1.30.347Potri.013G059700.1.23.344Potri.019G032900.2.23.344Potri.007G078900.1.32.349
Potri.019G032900.1.23.372Potri.009G076500.1.22.344Potri.019G032900.3.10.243Potri.006G280400.1
Prunus persicappa004964m.23.342ppa004814m.28.346ppa004643m.29.346ppa017632m.27.346ppa004783m.34.352
ppa018453m.25.343ppb004066m.23.346
Ricinus communis29777.m000270.23.34128226.m000880.29.34729950.m001151.23.34429836.m000569.26.34429739.m003664.43.360
29848.m004686.31.35027758.m000328.29.34730156.m001714.150.25830156.m001714.150.258
Setaria italicaSi017029m.31.348Si013645m.29.346Si008675m.29.344Si029637m.27.346Si035361m.32.352
Si013637m.26.346Si029650m.26.347Si035326m.33.355Si035350m.29.351Si024796m.35.354
Si026278m.25.349Si040250m.33.351
Selaginella moellendorffii171231.35.357267465.14.33389756.46.36786140.29.346236210.24.343
233394
Sorghum bicolorSb04g003170.2.30.347Sb04g003170.1.30.347Sb07g006340.1.34.352Sb10g022940.1.41.357Sb02g017290.1.28.347
Sb01g033200.1.31.352Sb01g005610.1.31.353Sb02g003910.1.29.350Sb09g026690.1.31.350Sb01g012900.1.31.353
Sb05g022490.1.26.349Sb01g038220.1.32.350
Thellungiella halophilaThhalv10013422m.22.340Thhalv10025047m.27.345Thhalv10024947m.23.336Thhalv10013340m.31.353Thhalv10022665m.25.343
Thhalv10002822m.84.404Thhalv10015448m.32.348Thhalv10020592m.33.352Thhalv10004092m.29.347Thhalv10012621m.26.345
Vitis viniferaGSVIVT01034245001.24.342GSVIVT01033384001.25.344GSVIVT01014995001.26.343GSVIVT01022253001GSVIVT01030073001.23.347
GSVIVT01015435001.547.841
Zea maysAC217887.3_FGT004.31.353AC159612.1_FGT007.26.314
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)