y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma04g41891.1
FamilyGH9
Protein PropertiesLength: 661 Molecular Weight: 73325.9 Isoelectric Point: 8.4267
ChromosomeChromosome/Scaffold: 04 Start: 47707612 End: 47714841
Descriptionglycosyl hydrolase 9A1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH91073970
  DAQKSGHYPRNIPGKFRRDSGLQDGDLSKTDFTGGFYDSGNNIKFTITTAYTVTLLSWTVVEYRSKYADIGELDHVSDILRWGSDYLLKQRPEDMKYERP
  VSICDGSASDLAGEIVAALSASSMVFKEDKDYSRRLVQAAESLFEAITSEDPSKQGTYTVAECGKQARMLYNSTSYKDELAWGATWLFLATENADYLATA
  TEIFLSAKGNESSFAYRIRYFRDPGFPLEDALKLSSNSTDALMCSYLFNKYFSRTSGGLIILKPDNGSLVQYAATASFLSKLYSDYHDHLK
Full Sequence
Protein Sequence     Length: 661     Download
QRATLRYVHT VSEAGRLLPS ASRWNFIVLD FKLAPNSSTA YESIPSQYPK SVDFNLAITD    60
RKHFHIFIFV LVAIIFAILA AVLLAHFLPQ QHKHQGSSIN LKLAINDAQK SGHYPRNIPG    120
KFRRDSGLQD GDLSKTDFTG GFYDSGNNIK FTITTAYTVT LLSWTVVEYR SKYADIGELD    180
HVSDILRWGS DYLLKQRPED MKYERPVSIC DGSASDLAGE IVAALSASSM VFKEDKDYSR    240
RLVQAAESLF EAITSEDPSK QGTYTVAECG KQARMLYNST SYKDELAWGA TWLFLATENA    300
DYLATATEIF LSAKGNESSF AYRIRYFRDP GFPLEDALKL SSNSTDALMC SYLFNKYFSR    360
TSGGLIILKP DNGSLVQYAA TASFLSKLYS DYHDHLKMSG AIYVFLAGLN SHLDAVRGHI    420
LSTTPLPNFQ SVYATVFAKA NRQEAMLDSE STMGIAFAVK KYSKKGIRKC THCNRDNHVM    480
ETCFKLHGHP DWHLKGKTTP NAKVDAISKS HISTVVVFVT KSGISNSALN LSVVTRGSGW    540
ITDSGATDHM TCDPHKFTSF SHDCSKTFII NVHHKSASIP WNNQPYTCDK GKQWLNSKDP    600
NPQVLLGAMV GGPDTNDDFM DQRTKQKFTE PNIASNAGLA AAIIALQDPP YNSRDFKNSL    660
*                                                                    720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00759Glyco_hydro_91.0e-757062455+
PLN02345PLN023452.0e-1257163161+
PLN02909PLN029099.0e-4994391342+
PLN02345PLN023454.0e-54101392340+
pfam00759Glyco_hydro_92.0e-59107392327+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAQ63883.1014018464cellulase [Medicago truncatula]
GenBankAAQ63883.12e-35568660505597cellulase [Medicago truncatula]
EMBLCBI19980.10340116475unnamed protein product [Vitis vinifera]
RefSeqXP_002526151.10740015460endo-1,4-beta-glucanase, putative [Ricinus communis]
RefSeqXP_002526151.18e-23572648506582endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A2e-3010331013239A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
PDB1ksd_A0.000000003573646359428A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
PDB1ksc_A2e-3010331013239A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
PDB1ksc_A0.000000003573646359428A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
PDB1ks8_A2e-3010331013239A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
6688
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BQ1655672611823920
JK8405772251964010
BF010444352983920
HO778339357983940
BF010444745586310.00000000004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00010.1Aquca_058_00008.1Aquca_014_00010.2Aquca_014_00403.1
Arabidopsis lyrata495032858221894138
Arabidopsis thalianaAT5G49720.1AT4G24260.1AT1G65610.1
Brachypodium distachyonBradi1g09460.1Bradi1g63560.1Bradi5g14580.1
Brassica rapaBra000594Bra040496Bra019237Bra013781Bra022470
Bra016970Bra039767
Carica papayaevm.model.supercontig_17.23evm.model.supercontig_88.37evm.model.supercontig_151.55evm.model.supercontig_49.52
Capsella rubellaCarubv10027986mCarubv10004382mCarubv10019972m
Citrus clementinaCiclev10000600mCiclev10014583mCiclev10024241mCiclev10003884mCiclev10003122m
Citrus sinensisorange1.1g007014morange1.1g007041morange1.1g013516morange1.1g046335morange1.1g013288m
orange1.1g041590morange1.1g043321m
Cucumis sativusCucsa.260330.1Cucsa.178750.1Cucsa.212770.1
Eucalyptus grandisEucgr.G00035.1Eucgr.A00393.1Eucgr.G00035.2Eucgr.F02731.1
Fragaria vescamrna29283.1-v1.0-hybridmrna25126.1-v1.0-hybrid
Glycine maxGlyma09g02160.1Glyma15g13080.1Glyma17g00710.1Glyma07g40090.1Glyma20g06820.1
Glyma06g12910.2Glyma06g12910.3
Gossypium raimondiiGorai.011G089500.1Gorai.010G143300.1Gorai.010G143300.2Gorai.008G141900.1Gorai.010G143300.3
Gorai.011G089500.2Gorai.003G089600.1Gorai.003G089600.2Gorai.003G089600.3
Linum usitatissimumLus10026275Lus10012162Lus10026863Lus10018918Lus10028619
Lus10010029Lus10036331Lus10007584
Malus domesticaMDP0000225700MDP0000388002MDP0000452189MDP0000518321MDP0000313820.215.533
MDP0000313820.215.533MDP0000308015MDP0000896140MDP0000140066.486.637MDP0000140066.486.637
MDP0000221017MDP0000160026MDP0000313820.118.215MDP0000313820.118.215MDP0000144703
Manihot esculentacassava4.1_003705mcassava4.1_003712mcassava4.1_026565m
Medicago truncatulaMedtr2g028480.1Medtr3g082440.1Medtr3g090540.1Medtr4g128810.1
Mimulus guttatusmgv1a003033mmgv1a002977mmgv1a002970mmgv1a002960mmgv1a022358m
mgv1a018926mmgv1a018124mmgv1a024415mmgv1a026839m
Oryza sativaLOC_Os03g21210.1LOC_Os03g52630.1LOC_Os03g52630.2LOC_Os04g41970.1LOC_Os12g24040.1
Panicum virgatumPavirv00061241mPavirv00029143mPavirv00040687mPavirv00029144mPavirv00038435m
Pavirv00038432mPavirv00007671mPavirv00061242mPavirv00005986mPavirv00061243m
Pavirv00044338mPavirv00049329mPavirv00048097m
Physcomitrella patensPp1s190_6V6.1Pp1s157_35V6.1Pp1s35_333V6.1Pp1s15_429V6.1Pp1s64_152V6.1
Phaseolus vulgarisPhvul.003G089600.1Phvul.006G133700.1Phvul.006G004900.1Phvul.009G135900.1
Picea abiesMA_69345g0010MA_102312g0010.133.408MA_102312g0010.133.408MA_9211546g0010MA_102312g0010.413.556
MA_102312g0010.413.556MA_6683906g0010.193.294MA_6683906g0010.193.294
Populus trichocarpaPotri.003G151700.1Potri.003G151700.2Potri.001G078900.1Potri.003G151700.3Potri.010G177300.1
Potri.008G079500.1Potri.010G177300.3Potri.010G177300.2Potri.003G151700.4Potri.005G188500.1
Potri.002G071200.1
Prunus persicappa002911mppa014845mppa026228mppa019140m
Ricinus communis30063.m00143629929.m00450230076.m00469627985.m000864
Setaria italicaSi034713mSi009616mSi012680mSi035386m
Selaginella moellendorffii26652275214
Sorghum bicolorSb01g036480.1Sb01g008860.1Sb06g021440.1
Thellungiella halophilaThhalv10012978mThhalv10024681mThhalv10018270mThhalv10003366mThhalv10012932m.108.387
Thhalv10012932m.108.387Thhalv10012932m.412.610Thhalv10012932m.412.610
Vitis viniferaGSVIVT01023102001GSVIVT01006265001GSVIVT01010049001GSVIVT01006152001
Zea maysAC199765.4_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)