y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma05g08020.2
FamilyGH17
Protein PropertiesLength: 823 Molecular Weight: 89166.7 Isoelectric Point: 9.9941
ChromosomeChromosome/Scaffold: 05 Start: 7939394 End: 7945170
DescriptionPlant protein of unknown function (DUF936)
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH17291211.7e-26
  VGVNWGTMATHKLPPNKVVKMLQENGFDKLKLFDAEEWIMAALMGTDIEVMLAIPNNMLEEMSRNPQVADSWVYENVTSYMYPGGLNIKAIAT
Full Sequence
Protein Sequence     Length: 823     Download
MAQEKALRVR YLVAFLLVFF TMASCGSGVG VNWGTMATHK LPPNKVVKML QENGFDKLKL    60
FDAEEWIMAA LMGTDIEVML AIPNNMLEEM SRNPQVADSW VYENVTSYMY PGGLNIKAIA    120
TMASLTPGIL LKMLQAMNTN TRVTGDHRSP LLQVIGIVPA LAGSDLWSNQ GFYLNLSDSV    180
NSTYVLLSHP DTDLILSNRL QLGQFVHVDR FHFDSPLPSV SNLRPLAGRH PFLGTPEPLI    240
ARISPSTRHF LIQPLSDSEL DPLSLLSLNN NNKSPIPNPN PNPNHNHEEH KQHHKDSSKE    300
RISRDPLAPR DNNLPPQRFS SPATAKRSQS AGRNKIVSTT AERDPSPAGK GKRSASPVPS    360
KCVVPSLVSA REENRKVSRE PAIIVPSRYR QPSPTGRKQP SSSPRRTSLS PGRRLSGGLK    420
VSPLVADSSV KKKMATIVAG ISKVSDALVG SKSARKNWDE QLPATPVEAG GSKSKVDAQA    480
ILRTQAAMSR RLSDVSGQKP GSNDSSSNEK TKAVSPQSCV LEDKSNFAAM GITIHEKKWT    540
DGSVPLDAVS GNLARLGKEA MQRKILASTA AAEALEEANA TECIIRNLSM FSDLCSVCQA    600
RNPLPTIDRF FTIYDDVLKS TAMVESVASR HNSETPDEGI PTKHSKSLSF WVEAALATDL    660
QIVSLLTGTT VDPPSTLQKS LSKRQSLGAA KNLKVRSSPQ SSLSTGVWTG GSGMKETVEL    720
GANLLSEMQM WFLRFVEESL DAGFKVFGEC TADGKKALPL DGGSIAVVLS HLKRVNAWLD    780
RVVSKGDDSL TEKIEKLKRK IYGFVIQHVG TTFDSSASSA SS*                      840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04057Rep-A_N0.00512521187+
cd04477RPA1N0.00115021162+
pfam00332Glyco_hydro_173.0e-1329128100+
pfam06075DUF9362.0e-109125814697+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI28115.101228151650unnamed protein product [Vitis vinifera]
RefSeqNP_193073.101228191673unknown protein [Arabidopsis thaliana]
RefSeqXP_002281524.101228151698PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324965.101228181703predicted protein [Populus trichocarpa]
RefSeqXP_002515571.101228221684conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0.00000000129128198A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D0.000000229127297A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C0.000000229127297A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B0.000000229127297A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A0.000000229127297A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Transmembrane Domains
StartEnd
1234
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9797902325838140
CA8530761835837650
DY2934913531214590
EY4752602601153740
FC8949512931213990
Orthologous Group
SpeciesID
Arabidopsis lyrata899941
Carica papayaevm.model.supercontig_27.199
Fragaria vescamrna27049.1-v1.0-hybrid
Linum usitatissimumLus10020526
Malus domesticaMDP0000908326MDP0000233619MDP0000227501MDP0000631129MDP0000224162
Manihot esculentacassava4.1_024233m
Panicum virgatumPavirv00021846m
Picea abiesMA_17339g0010MA_8517491g0010MA_1055674g0010MA_6742g0010MA_8478g0010
MA_10437110g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny