y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma05g21081.1
FamilyPL1
Protein PropertiesLength: 229 Molecular Weight: 26106.3 Isoelectric Point: 4.8866
ChromosomeChromosome/Scaffold: 05 Start: 25416631 End: 25418058
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1271511.90002e-41
  QTESDRDGISIFGPKDIWIDHYTLSRCKDGLIDAVMGSIGITINNMLSHHNEVMLLGHSDDYLPDSGMQVTIAFNHFGEKLVQRMPRCRRGYIHVINNDF
  TEWEMYAIGGSGEPTINSQGNRYMA
Full Sequence
Protein Sequence     Length: 229     Download
MASSKKNNEC SERLSEAQSS PEHYGFQTES DRDGISIFGP KDIWIDHYTL SRCKDGLIDA    60
VMGSIGITIN NMLSHHNEVM LLGHSDDYLP DSGMQVTIAF NHFGEKLVQR MPRCRRGYIH    120
VINNDFTEWE MYAIGGSGEP TINSQGNRYM APENPFAKEV TKRVDTQQSK WKGWNWRSEG    180
DILLNGAFFV ASGEELEVKY EKTYIELMKF ITDRLGPDEE VFNILFFL*                240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB4.0e-1833164145+
pfam00544Pec_lyase_C2.0e-4619149140+
smart00656Amb_all3.0e-5130152133+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM61400.1015204203393pectate lyase-like protein [Arabidopsis thaliana]
EMBLCAB64222.1015204184374pectate lyase-like protein [Arabidopsis thaliana]
RefSeqNP_566979.1015204204394pectate lyase family protein [Arabidopsis thaliana]
RefSeqXP_002326380.1015204135325predicted protein [Populus trichocarpa]
RefSeqXP_002519460.1015204200390Pectate lyase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B031198149318A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A031198149318A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1vbl_A0.0000000000330124187299A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3zsc_A0.0000000000831151115248A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1pe9_B0.000000000239216151357A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR088237185212040
ES923365186151990
EC956551191152040
EV166854178181940
DV139227179151920
Orthologous Group
SpeciesID
Brassica rapaBra034884Bra040506
Glycine maxGlyma05g21081.2
Malus domesticaMDP0000125554MDP0000300492MDP0000256989
Picea abiesMA_614767g0010MA_204440g0010MA_10433252g0010MA_91467g0020
Populus trichocarpaPotri.006G196400.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny