y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma05g21081.2
FamilyPL1
Protein PropertiesLength: 168 Molecular Weight: 19259.8 Isoelectric Point: 5.0301
ChromosomeChromosome/Scaffold: 05 Start: 25416631 End: 25418416
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL17903.4e-28
  TINNMLSHHNEVMLLGHSDDYLPDSGMQVTIAFNHFGEKLVQRMPRCRRGYIHVINNDFTEWEMYAIGGSGEPTINSQGNRYMA
Full Sequence
Protein Sequence     Length: 168     Download
MGSIGITINN MLSHHNEVML LGHSDDYLPD SGMQVTIAFN HFGEKLVQRM PRCRRGYIHV    60
INNDFTEWEM YAIGGSGEPT INSQGNRYMA PENPFAKEVT KRVDTQQSKW KGWNWRSEGD    120
ILLNGAFFVA SGEELEVKYE KTYIELMKFI TDRLGPDEEV FNILFFL*                 180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB2.0e-106103102+
pfam00544Pec_lyase_C9.0e-3428888+
smart00656Amb_all7.0e-3719192+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM61400.101143250393pectate lyase-like protein [Arabidopsis thaliana]
EMBLCAB64222.101143231374pectate lyase-like protein [Arabidopsis thaliana]
RefSeqNP_566979.101143251394pectate lyase family protein [Arabidopsis thaliana]
RefSeqXP_002326380.101143182325predicted protein [Populus trichocarpa]
RefSeqXP_002519460.101143247390Pectate lyase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B1.99993e-411137180318A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A1.99993e-411137180318A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pe9_B0.00000012155192357A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pe9_A0.00000012155192357A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1ooc_B0.00000012155192357A Chain A, Mutations In The T1.5 Loop Of Pectate Lyase A
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG85540313591430
GO52549914411430
DK55294014411430
DK52058114411430
CK28745114411430
Orthologous Group
SpeciesID
Brassica rapaBra034884Bra040506
Glycine maxGlyma05g21081.1
Malus domesticaMDP0000125554MDP0000300492MDP0000256989
Picea abiesMA_614767g0010MA_204440g0010MA_10433252g0010MA_91467g0020
Populus trichocarpaPotri.006G196400.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny