y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma05g27431.1
FamilyGT57
Protein PropertiesLength: 384 Molecular Weight: 43028.9 Isoelectric Point: 8.6903
ChromosomeChromosome/Scaffold: 05 Start: 33362847 End: 33368939
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT5723750
  LFIVDHVHFQYNGFLIGILLISLSYLEEGRDLLGGFVFAVLLCFKHLFAVAAPVYFVYLLRHYCWGGTVRGIGRLLIMGGVVTAVFASAFGPFFHLGQTQ
  QIIQRLFPFGRGLCHAYWAPNFWVFYIMSDKGLAFIFRKLGFNVQTPTGSFTAGLVGDSSPFSVLPQITPFVTFIMVLLALSPCLFKAWKNPQPQMISRW
  IAYAYTCGFLFGWHVHEKASLHFVIPLAIVAPQTLEDARHYFLLSIVSCYSIFPLLFEAQENSIKVLLLLLHSILMWSGFSAQFCDGAEATRAPTANSKK
  NADQFVSEGNSGATVNKGFAIGWIERIYLIGLVVVEIWGQILYPLLLGDKFAFAPLMLISIYCAFGIMYSWIWQ
Full Sequence
Protein Sequence     Length: 384     Download
MLFIVDHVHF QYNGFLIGIL LISLSYLEEG RDLLGGFVFA VLLCFKHLFA VAAPVYFVYL    60
LRHYCWGGTV RGIGRLLIMG GVVTAVFASA FGPFFHLGQT QQIIQRLFPF GRGLCHAYWA    120
PNFWVFYIMS DKGLAFIFRK LGFNVQTPTG SFTAGLVGDS SPFSVLPQIT PFVTFIMVLL    180
ALSPCLFKAW KNPQPQMISR WIAYAYTCGF LFGWHVHEKA SLHFVIPLAI VAPQTLEDAR    240
HYFLLSIVSC YSIFPLLFEA QENSIKVLLL LLHSILMWSG FSAQFCDGAE ATRAPTANSK    300
KNADQFVSEG NSGATVNKGF AIGWIERIYL IGLVVVEIWG QILYPLLLGD KFAFAPLMLI    360
SIYCAFGIMY SWIWQLISIV KSR*                                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg85.0e-552374375+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI16712.102382108471unnamed protein product [Vitis vinifera]
GenBankEAY87118.102381150517hypothetical protein OsI_08520 [Oryza sativa Indica Group]
RefSeqNP_001047779.102381147514Os02g0688500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_181994.502380145505transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002269114.102382152531PREDICTED: hypothetical protein [Vitis vinifera]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5471EC-2.4.1.265Dol-P-Glc:Glc1Man9GlcNAc2-PP-Dol α-1,3-glucosyltransferase
Transmembrane Domains
StartEnd
1027
3658
7395
108130
165187
320342
352374
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV2676292531253770
EY098403315683820
GR84129921712170
GW957433231682980
FG344637243312730
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00352.1
Arabidopsis lyrata903892
Arabidopsis thalianaAT2G44660.1
Brachypodium distachyonBradi3g52040.1
Brassica rapaBra004854
Carica papayaevm.model.supercontig_50.144
Capsella rubellaCarubv10023047m
Chlamydomonas reinhardtiiCre09.g414250.t1.3.19.125Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.19.125
Citrus clementinaCiclev10014906m
Citrus sinensisorange1.1g019776morange1.1g026008morange1.1g009885m
Cucumis sativusCucsa.362250.1
Eucalyptus grandisEucgr.E01703.1
Fragaria vescamrna03056.1-v1.0-hybrid
Glycine maxGlyma08g10420.1Glyma05g27431.2
Gossypium raimondiiGorai.003G062300.1
Linum usitatissimumLus10043344Lus10019495
Malus domesticaMDP0000238047
Manihot esculentacassava4.1_005358m
Medicago truncatulaMedtr5g077540.1
Mimulus guttatusmgv1a004526m
Oryza sativaLOC_Os02g46320.1
Panicum virgatumPavirv00056060mPavirv00065643m
Physcomitrella patensPp1s34_140V6.1
Phaseolus vulgarisPhvul.007G221000.2Phvul.007G221000.1
Picea abiesMA_10429975g0010MA_7890741g0010
Populus trichocarpaPotri.014G053200.1
Prunus persicappa016151mppa004246m
Ricinus communis29634.m002078.26.16329634.m002078.26.16329634.m002078.164.48529634.m002078.164.485
Setaria italicaSi016919m
Selaginella moellendorffii45405.175.35645405.175.356
Sorghum bicolorSb04g031440.1
Thellungiella halophilaThhalv10001410m
Vitis viniferaGSVIVT01018341001
Volvox carteriVocar20011939m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny