y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma05g30230.1
FamilyGT24
Protein PropertiesLength: 1628 Molecular Weight: 184600 Isoelectric Point: 5.6459
ChromosomeChromosome/Scaffold: 05 Start: 35633018 End: 35658894
DescriptionUDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT24132115680
  INMVSIASGHLYERFMKIMILSVLKNTHRPVKFWFIKNYLSPPFKDLIPHMALEYGFEYELVTYKWPTWLHKQKEKQRIIWAYKILFLDVIFPLSLEKVI
  FVDADQVVRADMGVLYDMDIRGKPLAYTPFCDNNKEMDGYRFWRQGFWNDHLQGKPYHISALYVVDLKKFRETAAGDNLRVIYETLSRDPNSLANLDQDL
  PNYAQHTVPIFSLPQEWLWCESWCGNATKYKAKTIDLCNNPMTKEPKL
Full Sequence
Protein Sequence     Length: 1628     Download
MGCLWRSRCW VLIVLVLLNI GSAFADTPQR PKNVQTALRA KWSGTPLLLE AAELLSNEKK    60
DLFWDFIEIW LNTEKDAARS EAAKDCVKKI LECGRPLLRE PLKSLFEFSL MLRSASPRLV    120
LFQQLAEESL ASFPLGDENY SDDETEEKLL TEKKIERRKL DPLHGVNLKI HGGKCCWVDT    180
GEHLFLDVHE LLAWLQGSVE LVGDSFPRPE IFDFDHIYYE LSVGSPVAIL YGALGTNCFK    240
EFHVALVKAA KEGKVKYVLR PVLPAGCESK INHCGSVGAG ESVNLGGYGV ELALKNMEYK    300
AMDDSTVKKG VTLEDPRTED LSQEVRGFIF SKILERKTEL TSEVMAFRDY LLSSTVSDTL    360
DVWELKDLGH QTVQRIVRAS DPLQSMQEIN QNFPSIVSSL SRTKLDDSIR DEIMANQRMV    420
PPGKSLMALN GALVNVEDVD LYLLIDLIHQ DLLLADQFSK LKIPQGTLKK LLSTSPPSES    480
SIFRVDFHSS HVHYLNNLEE DAKYKRWRNN LDEFLMPVFP GQLRYIRKNL FHAVFVLDPA    540
TRCGLVSIDM IISLYENNFP VRFGIVLYSS KFVMQLENHA TKEHSDEDIS TTIICLFSYI    600
NENYGAEMAY RFLSNVNKLR IESDGNADDA LELHHVEGVF VETILSKVKS PPQEILLKLY    660
KNQKLKELSQ ESSKFVFKLG LSKLQCSLLM NGLVIDPTEE ALINALNDET PRIQEQVYFG    720
QIMSDTDVLA KFLSEAGIQR YNPKIISDSK PRFISLSMFT FGEESILNDI VYLHSPGTMD    780
DTKAVTHLLA VDITSRNGMK LLQQGIHYLI EGSKNARVGL LFNANRSPNL FSLLFVKVFE    840
ITASLYSHKT NVLDFLNQLC SLYEKNYILS PPMEAESTQA FVDMVCELGE ANGLPSKGYR    900
SALLEFPAGE VRKHLTKVQN SLYRVLGLES GANAVFTNGR VTYPIDESSF LSADLHLLES    960
IEFKQRTKHI VEIIEEVEWH DVDPDTLTSK FISDIVMALS SSMAMRERNS ESARFEILND    1020
QHSVIILNNV NSSIHIDAVL DPLSPTSQRL SGILRVLWKY IQPSMRIVLN PVSSLADLPL    1080
KSYYRYVVPT MDDFSNTDSA INGPQALFAN MPLSKTLTMN LDVPESWLVE PVIAFHDLDN    1140
ILLENLGDTS TLQAVFELEA LVLTGHCSEK DHDPPRGLQL ILGTKTAPHL VDTLVMANLG    1200
YWQMKVSPGV WYLQLAPGRS SELYILKEDG EGSYDKQSSK LITINDLRGK LFHMEVLKKK    1260
GKEHEELLLP DDNAQDEKKG SGLNSNFLEW ASGFIGGNKL SKKAEKSSQE KGRGGRHGKT    1320
INMVSIASGH LYERFMKIMI LSVLKNTHRP VKFWFIKNYL SPPFKDLIPH MALEYGFEYE    1380
LVTYKWPTWL HKQKEKQRII WAYKILFLDV IFPLSLEKVI FVDADQVVRA DMGVLYDMDI    1440
RGKPLAYTPF CDNNKEMDGY RFWRQGFWND HLQGKPYHIS ALYVVDLKKF RETAAGDNLR    1500
VIYETLSRDP NSLANLDQDL PNYAQHTVPI FSLPQEWLWC ESWCGNATKY KAKTIDLCNN    1560
PMTKEPKLQG ARRIVSEWPD LDFEARRFTA RILGDDQESE SILPPNQSKN LNSEDSSNED    1620
MESRAEL*                                                             1680
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01501Glyco_transf_80.00213401520189+
cd04194GT8_A4GalT_like2.0e-1213321537216+
cd00505Glyco_transf_89.0e-5313211568257+
pfam06427UDP-g_GGTase3.0e-769931198212+
cd06432GT8_HUGT1_C_like2.0e-16713211568248+
Gene Ontology
GO TermDescription
GO:0003980UDP-glucose:glycoprotein glucosyltransferase activity
GO:0006486protein glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG51883.101162711674AC016162_4 putative UDP-glucose:glycoprotein glucosyltransferase; 101200-91134 [Arabidopsis thaliana]
RefSeqNP_177278.301162711613EBS1 (EMS-mutagenized bri1 suppressor 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002268972.101162711611PREDICTED: similar to EBS1 (EMS-MUTAGENIZED BRI1 SUPPRESSOR 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Vitis vinifera]
RefSeqXP_002454743.10291619371563hypothetical protein SORBIDRAFT_04g036540 [Sorghum bicolor]
RefSeqXP_002529534.101151811499UDP-glucose glycoprotein:glucosyltransferase, putative [Ricinus communis]
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO415354549106415920
HO797114337127116070
GO883503327128216060
DR944618278131415910
HO41535415990810654e-18
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_023_00011.1
Arabidopsis lyrata894960
Arabidopsis thalianaAT1G71220.2AT1G71220.1
Brachypodium distachyonBradi3g28605.1
Brassica rapaBra016154
Capsella rubellaCarubv10022452m
Chlamydomonas reinhardtiig5108.t1g5108.t2
Citrus clementinaCiclev10000024m
Citrus sinensisorange1.1g001078morange1.1g000334morange1.1g000842morange1.1g001779morange1.1g000402m
orange1.1g000446morange1.1g000445m
Cucumis sativusCucsa.033020.2Cucsa.033020.1
Eucalyptus grandisEucgr.H01580.1Eucgr.I02739.1Eucgr.H01552.1.95.175Eucgr.H01552.1.95.175
Fragaria vescamrna11048.1-v1.0-hybrid
Glycine maxGlyma20g20260.1Glyma08g20020.1Glyma08g20020.2Glyma08g13400.1
Gossypium raimondiiGorai.012G151700.5Gorai.008G027900.1Gorai.012G151700.3Gorai.012G151700.2Gorai.012G151700.4
Linum usitatissimumLus10019946Lus10015475
Malus domesticaMDP0000231077MDP0000439201
Manihot esculentacassava4.1_000150m
Medicago truncatulaMedtr2g006960.1
Mimulus guttatusmgv1a000151m
Oryza sativaLOC_Os02g44510.3LOC_Os02g44510.2LOC_Os02g44510.1
Panicum virgatumPavirv00007561mPavirv00061408m
Physcomitrella patensPp1s25_65V6.1
Phaseolus vulgarisPhvul.006G215600.1
Picea abiesMA_10435601g0010
Populus trichocarpaPotri.003G018900.1
Prunus persicappa000323m
Ricinus communis29222.m000396
Setaria italicaSi033881m
Selaginella moellendorffii186368
Sorghum bicolorSb04g036540.1
Thellungiella halophilaThhalv10018004m
Vitis viniferaGSVIVT01022867001
Volvox carteriVocar20012786m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny