y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma05g31460.1
FamilyGH5
Protein PropertiesLength: 504 Molecular Weight: 57119.2 Isoelectric Point: 5.9136
ChromosomeChromosome/Scaffold: 05 Start: 36593470 End: 36596293
Description
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52214870
  MRDHWNTYIIEDDFKFMSENGLNAVRIPVGWWTTQDPTPPKPFVGGSLEVLDNAFTWAEKYGIKVIVDLHAAPGSQNGRPHSASRDGYLEWGDSYISDTV
  ATIDFLAERYSNRSGLVAIELMNEPQGVNLESLKSYYQAGYDAVRKHTSSAYVIMSNPLDRDSKVLLSFAGAFSRVVIDVHYYNLFSDRFSNMNVQQNID
  FIKNQRASDLSSLTTSNGPLIFVGEWSSDWKVQSASKKDHQKFTQVQVDVYSRAKFGWAYWAYICDS
Full Sequence
Protein Sequence     Length: 504     Download
MMSNKLFYAN LVLAFYLSCH YALAQTENFP LPLKAVNLGN WLVIEGWMKP SLFDGITNKD    60
LLDGTQVQFM STKLQKYLCA EHGGGSVVVA NRTKASGWET FRLWRINEST FNFRVSNKQF    120
IRLTNRDGGS NLVADSDSPS DLETFEILRN DDDPNRVRIR APNGQFLQAI SETVVLANYE    180
GSSWDDSDPS IFKMNVLSGS IIRGEYQITN GYSPDKATKI MRDHWNTYII EDDFKFMSEN    240
GLNAVRIPVG WWTTQDPTPP KPFVGGSLEV LDNAFTWAEK YGIKVIVDLH AAPGSQNGRP    300
HSASRDGYLE WGDSYISDTV ATIDFLAERY SNRSGLVAIE LMNEPQGVNL ESLKSYYQAG    360
YDAVRKHTSS AYVIMSNPLD RDSKVLLSFA GAFSRVVIDV HYYNLFSDRF SNMNVQQNID    420
FIKNQRASDL SSLTTSNGPL IFVGEWSSDW KVQSASKKDH QKFTQVQVDV YSRAKFGWAY    480
WAYICDSNFW SIKWMIENNY IKL*                                           540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_420.0003223352147+
cd00257Fascin5.0e-675178104+
pfam00150Cellulase5.0e-21224483276+
COG2730BglC1.0e-31158499379+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankADD09589.1025031504unknown [Trifolium repens]
EMBLCBI18831.1085036505unnamed protein product [Vitis vinifera]
EMBLCBI33033.1065034505unnamed protein product [Vitis vinifera]
EMBLCBI33035.1084836485unnamed protein product [Vitis vinifera]
RefSeqXP_002306319.10345011481predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A2e-3320548345359A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB1eqc_A4e-3320548345359A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB1cz1_A4e-3320548345359A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A Resolution
Transmembrane Domains
StartEnd
724
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC8989053781295030
DC8992993191885030
CX664525329463720
GO0145182521974480
CX6663752852225030
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)