y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma05g32500.2
FamilyGT48
Protein PropertiesLength: 1866 Molecular Weight: 214773 Isoelectric Point: 9.0435
ChromosomeChromosome/Scaffold: 05 Start: 37421660 End: 37436677
Descriptioncallose synthase 5
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT4898717250
  VPTNSEVRRRVSFFTNSLFMDMPRAPRVRKMLSFSVLTPYYSEETVYSKNDIEVENEDGVSIIYYLQKIFPEEWNNFLERLECKKDSDIWEKEENILQLR
  HWASLRGQTLCRTVRGMMYYRRAIKLQAFLDMASEQEIFDGYKAIAVPSEEEKKSHRSLYANIEAMADLKFTYVATCQNYGNQKRCGDRRATDILNLMVN
  NPSLRVAYIDEVEEREAGKIQKVYYSVLIKAVDNLDQEIYRIKLPGPAKLGEGKPENQNHAIIFTRGEALQTIDMNQDNYLEEALKMRNLLEEFNEDHGV
  RPPTILGVREHIFTGSVSSLAWFMSNQETSFVTIGQRVLARPLKVRFHYGHPDVFDRIFHFTRGGISKASCGINLSEDIFAGFNSTLRRGNVTHHEYIQV
  GKGRDVGLNQISLFEAKVACGNGEQTLSRDIYRLGHRFDFFRMLSFYFTTVGFYVSSMLVAITVYAFLYGRFYLSLSGLEEAIIKIARKKGDDPLKAAMA
  SQSLVQIGLLMTLPMVMEIGLERGFRTALSDIIIMQLQLAPVFFTFSLGTKMHYFGRTLLHGGAKYRATGRGFVVRHERFADNYRMYSRSHFVKGIEIAI
  LLICYGLYGSATSDSTSYALLSLSMWFLACSWLFSPFLFNPSGFEWQKIVEDWEDWAKWISSRGGIGVPSNKSWESWWDEEQEHLQHTGIWGRIWEVILA
  LRFFVYQYGIVYHLHVARGDKSISVYGLSWLVVVAVIVI
Full Sequence
Protein Sequence     Length: 1866     Download
MSNPDQTVLN RRPSRSAATT TFSLEVFDNE VVPSALASIS PILRVANEIE TERPRVAYLC    60
RFYAFEKAHR LDQSSSGRGV RQFKTMLLQR LERDNPTSLA SRAKKTDARE IQSYYQQYYE    120
HYVRTLDQAD QADRAQLSKA YQTAGVLFEV LCAVNKTEKV EEVAPEIIAA ARDVQEKTEI    180
YTPYNILPLD AAGASVPVMQ FEEIKAAVSA LWNTRGLNWP NSFEQQRQKT GDLDMLDWLR    240
AMFGFQRDSV RNQREHLILL LANSHIRLHP KPEPFNLACI CLSHFLFQES LDDRAVDSVM    300
KDLFKNYKSW CKFLGRKHSL RLPQGQQEIQ QRKLLYMGLY LLIWGEASNA RFMPECLCYI    360
FHNMAYELHG LLAGNVSIVT GENIKPSYGG DDEAFLRKVI TPLYRVIEKE AKKSRHGKAP    420
HSAWCNYDDL NEYFWSSDCF SLGWPMRDDG EFFKSTSDLT QGRNGVPRKY GKTGKSNFVE    480
TRTFWHIFRS FDRMWTFFIL GLQKFISFLF LLYDLGILDV VLNFPGYHRW KFTEVLRNIL    540
KVFVSLFWVI ILPLFYVHSF KGAPEGLKQL LSFFKQIKGI PAFYMLAVAL YLLPNLLAAV    600
LFLFPMLRRW IENSDWHIVR FFLWWSQPSI YVGRGMHDSQ FALMKYTIFW LLLLTCKFLF    660
SFFVQIKPLV RPTKDIMSIR HVNYGWHAFF PNARNNYSAV VALWAPVLLV YFMDTQIWYA    720
IFSTLYGGLV GAFDRLGEIR TLRMLRSRFQ SLPGAFNTCL VPSDKKQKGR FSFSKQFAEM    780
DLLLVPYSSG HNLKIIQWPP FLLTSKITVA LDMASQFRGR DSDLWKRICA DEYMKCAVIE    840
CYESFKHVLH DLVIGETEKS IISSIIKEVE SNISKNTLLT NFRMGFLPSL CKKFVELVEI    900
MKNGDPSKQG TVVVLLQDML EVVTDMMVNE ISELAELNQS SKDAGQVFAG TEAKPAILFP    960
PVVTAQWEEQ IRRLYLLLTV KESAVEVPTN SEVRRRVSFF TNSLFMDMPR APRVRKMLSF    1020
SVLTPYYSEE TVYSKNDIEV ENEDGVSIIY YLQKIFPEEW NNFLERLECK KDSDIWEKEE    1080
NILQLRHWAS LRGQTLCRTV RGMMYYRRAI KLQAFLDMAS EQEIFDGYKA IAVPSEEEKK    1140
SHRSLYANIE AMADLKFTYV ATCQNYGNQK RCGDRRATDI LNLMVNNPSL RVAYIDEVEE    1200
REAGKIQKVY YSVLIKAVDN LDQEIYRIKL PGPAKLGEGK PENQNHAIIF TRGEALQTID    1260
MNQDNYLEEA LKMRNLLEEF NEDHGVRPPT ILGVREHIFT GSVSSLAWFM SNQETSFVTI    1320
GQRVLARPLK VRFHYGHPDV FDRIFHFTRG GISKASCGIN LSEDIFAGFN STLRRGNVTH    1380
HEYIQVGKGR DVGLNQISLF EAKVACGNGE QTLSRDIYRL GHRFDFFRML SFYFTTVGFY    1440
VSSMLVAITV YAFLYGRFYL SLSGLEEAII KIARKKGDDP LKAAMASQSL VQIGLLMTLP    1500
MVMEIGLERG FRTALSDIII MQLQLAPVFF TFSLGTKMHY FGRTLLHGGA KYRATGRGFV    1560
VRHERFADNY RMYSRSHFVK GIEIAILLIC YGLYGSATSD STSYALLSLS MWFLACSWLF    1620
SPFLFNPSGF EWQKIVEDWE DWAKWISSRG GIGVPSNKSW ESWWDEEQEH LQHTGIWGRI    1680
WEVILALRFF VYQYGIVYHL HVARGDKSIS VYGLSWLVVV AVIVILKIVS MGSKTFSADF    1740
QLMFRLLKLF LFIGTVVILT LMFALLSFTV GDIFASLLAF MPTGWAFIQI AQACRPLVKG    1800
IGMWGSIKAL SRGYEYVMGV LIFAPVAILA WFPFVSEFQT RLLYNQAFSR GLQIQRILAG    1860
GKKNK*                                                               1920
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04652DUF6052.0e-1337151118+
pfam14288FKS1_dom11.0e-55331447118+
pfam02364Glucan_synthase09871707805+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK49452.2091865261931AF304372_1 putative beta-1,3-glucan synthase [Nicotiana alata]
EMBLCAN80181.109186531933hypothetical protein [Vitis vinifera]
EMBLCBI37540.1091865111958unnamed protein product [Vitis vinifera]
RefSeqXP_002274337.1091865111918PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328472.101186511906predicted protein [Populus trichocarpa]
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
495517
538560
582604
616633
648670
700722
14321454
14811503
15181535
15761598
16031625
16801702
17121729
17491771
18131835
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO425519627124218630
HO780746507102115220
HO780496341129616360
HO780496133117712950
HO780496212161518250
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1Glyma13g37290.2
Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3Glyma18g12870.2
Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1Glyma15g42330.4
Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1Glyma08g47670.2
Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6Glyma18g13105.10
Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5Glyma18g13105.4
Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5Glyma08g42110.1
Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4Glyma10g44150.2
Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)