y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma05g34250.2
FamilyGT28
Protein PropertiesLength: 408 Molecular Weight: 44027.7 Isoelectric Point: 7.9194
ChromosomeChromosome/Scaffold: 05 Start: 38640534 End: 38646746
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT282223822.00386e-43
  LLVLAGSFGANAVNIAMLNLYYQMLRQDSGLYVIWQTGVEAFDEMDSLVKTHPRLYITPFMHCMGLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPN
  FSEGNQFRNASLMADLAGVTVITEDELDSSTLAIAIEKILRDKKKMEDMSERALKAANPNA
Full Sequence
Protein Sequence     Length: 408     Download
MLMATTLSFS FPVFQSTPLS RRVSISCHSS NSNNETLRVA FAGGGTGSNV YPAVAIAEEL    60
KTANPTCQFL FLCTPDSVES AAISSAGYDF ASVSSPPQNL LFFPHRLFKS LIQCLCHLRH    120
FQPDVVVGTG GYVSFPACLA AKLRGTNVVI HEPNSVPGFA NSLLSFFADA IFVAFNSTLD    180
SFPRNKCFVC GNPVRLSIRN LVSKVTAMSH FFPGSDSGSR ILLVLAGSFG ANAVNIAMLN    240
LYYQMLRQDS GLYVIWQTGV EAFDEMDSLV KTHPRLYITP FMHCMGLAYA AADLIVSRAG    300
AMTCYEILAT GKPSILIPSP NFSEGNQFRN ASLMADLAGV TVITEDELDS STLAIAIEKI    360
LRDKKKMEDM SERALKAANP NASAEIAKHI LSLVNLSTKE KRNTATK*                 420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK12446PRK124467.0e-3138395378+
COG0707MurG3.0e-8038395364+
TIGR01133murG1.0e-8638390360+
PRK00726murG9.0e-10838394364+
cd03785GT1_MurG7.0e-12038389359+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI15500.102040134436unnamed protein product [Vitis vinifera]
RefSeqNP_177515.102839943431glycosyl transferase family 28 protein [Arabidopsis thaliana]
RefSeqXP_002277203.102640145431PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002317900.103739932402predicted protein [Populus trichocarpa]
RefSeqXP_002524882.102540144437UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A2e-38393835344A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_B9e-37333903350A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_A9e-37333903350A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1f0k_B9e-37333903350A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
PDB1f0k_A9e-37333903350A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
Transmembrane Domains
StartEnd
221243
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES821435356363750
CO1158432731183830
CO0939912581333830
DW243293286473170
FG1565052451543940
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01253.1
Arabidopsis lyrata316317
Arabidopsis thalianaAT1G73740.1
Brachypodium distachyonBradi2g13780.1
Brassica rapaBra015969
Carica papayaevm.model.supercontig_3.458
Capsella rubellaCarubv10022300m
Chlamydomonas reinhardtiiCre12.g527950.t1.3
Citrus clementinaCiclev10020201m
Citrus sinensisorange1.1g031484m
Cucumis sativusCucsa.121750.1
Eucalyptus grandisEucgr.K02237.1
Fragaria vescamrna09449.1-v1.0-hybrid
Glycine maxGlyma08g05420.2Glyma05g34250.3
Gossypium raimondiiGorai.001G067900.3Gorai.001G067900.1
Malus domesticaMDP0000880838MDP0000170708
Manihot esculentacassava4.1_029849m
Oryza sativaLOC_Os01g33230.1
Physcomitrella patensPp1s21_151V6.1
Phaseolus vulgarisPhvul.002G325300.1
Picea abiesMA_159099g0140
Populus trichocarpaPotri.012G053600.1
Prunus persicappa005855m
Ricinus communis29747.m00107734442.m000027
Setaria italicaSi001498m
Selaginella moellendorffii123054121052
Sorghum bicolorSb03g015470.1
Thellungiella halophilaThhalv10018574mThhalv10018576m
Vitis viniferaGSVIVT01008345001
Volvox carteriVocar20003855m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny