y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma05g35860.2
FamilyGT21
Protein PropertiesLength: 524 Molecular Weight: 59073.2 Isoelectric Point: 7.5366
ChromosomeChromosome/Scaffold: 05 Start: 39824741 End: 39831138
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT21853111.3e-34
  PRVTVIMPLKGFGEHNLHNWRSQITSLYGGPIEFLFVVESTEDPAFHAVSRLIAEFEDHVEAKVVVSGLSTTCSQKIHNQLVGVETMHKDSKYVLFLDDD
  VRLHPGSIGALTREMEKNPEIFIQTGYPLDLPSGSLGSYCIYEYHMPCSMGFATGGKTFFLWGGCMMMHADDFRQDRYGVVSGLKDGGYSDDMTLAAISG
  AHKRLITSPPVAVFPHPLASDLNFGRY
Full Sequence
Protein Sequence     Length: 524     Download
MNATMSSLDL LLFSLSRAFC SSIAVFFQIQ GCLICLTLAL GWACAAYVRN REIKQMKDCM    60
KNDNSFSFLC HDISELEHSY QVNLPRVTVI MPLKGFGEHN LHNWRSQITS LYGGPIEFLF    120
VVESTEDPAF HAVSRLIAEF EDHVEAKVVV SGLSTTCSQK IHNQLVGVET MHKDSKYVLF    180
LDDDVRLHPG SIGALTREME KNPEIFIQTG YPLDLPSGSL GSYCIYEYHM PCSMGFATGG    240
KTFFLWGGCM MMHADDFRQD RYGVVSGLKD GGYSDDMTLA AISGAHKRLI TSPPVAVFPH    300
PLASDLNFGR YWNYLRKQTF VLESYLTNVN WVMNRALFTT HCYLSWGFVA PYFMAMIHVA    360
AAVRFYYKGF SPEEMAYTSG GLSLVAFLAI CTLVELLSMW NLTRIEVQLC NMLSPEAPQL    420
FLASYNWCLV FIAMLVDNFL YPVSAFRSHF SQSINWSGIR YYLKDGKISK IERTPRSKDM    480
GPVFTDLGGK HLYGKKGLPT RGSFLSSLSR SLAQWHQPKK FDN*                     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03472HpnI3.0e-685201117+
pfam13641Glyco_tranf_2_32.0e-685258181+
COG1215COG12153.0e-984400332+
cd02520Glucosylceramide_synthase2.0e-985316237+
pfam13506Glyco_transf_213.0e-12143316178+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK73021.1015221519AF367245_1 ceramide glucosyltransferase [Gossypium arboreum]
GenBankABK95617.1075224516unknown [Populus trichocarpa]
RefSeqNP_565460.1035222518ceramide glucosyltransferase, putative [Arabidopsis thaliana]
RefSeqXP_002329645.101152211523predicted protein [Populus trichocarpa]
RefSeqXP_002514215.1015231522ceramide glucosyltransferase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
sphingolipid biosynthesis (plants)RXN-7793EC-2.4.1.80ceramide glucosyltransferase
Transmembrane Domains
StartEnd
2648
343365
380402
423445
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6984232891254130
DT4744412851784620
DV125113265963600
DT7651012791063840
EL441917271493190
Orthologous Group
SpeciesID
Arabidopsis lyrata319569
Arabidopsis thalianaAT2G19880.1AT2G19880.2
Brachypodium distachyonBradi2g58060.1
Brassica rapaBra036698Bra039028Bra031106
Carica papayaevm.model.supercontig_40.95
Capsella rubellaCarubv10013384m
Citrus clementinaCiclev10008006m
Citrus sinensisorange1.1g010062m
Cucumis sativusCucsa.288830.1
Eucalyptus grandisEucgr.C03729.1
Fragaria vescamrna11297.1-v1.0-hybrid
Glycine maxGlyma08g03760.1Glyma01g01130.1Glyma16g08510.1
Gossypium raimondiiGorai.010G077100.1Gorai.010G077100.2Gorai.009G027500.1Gorai.009G027500.2
Linum usitatissimumLus10034973
Malus domesticaMDP0000289917MDP0000035240MDP0000126193
Manihot esculentacassava4.1_005602mcassava4.1_007721m
Medicago truncatulaMedtr8g102490.1Medtr8g102500.1
Mimulus guttatusmgv1a004497mmgv1a004580m
Oryza sativaLOC_Os01g67870.1
Panicum virgatumPavirv00019095mPavirv00063321m
Physcomitrella patensPp1s194_131V6.1
Phaseolus vulgarisPhvul.004G176200.1Phvul.002G308700.1
Populus trichocarpaPotri.018G087700.3Potri.018G087700.2Potri.018G087700.1Potri.006G164800.2Potri.T063300.1
Potri.006G164800.1
Prunus persicappa004285mppa005382m
Ricinus communis29912.m005431
Setaria italicaSi001058m
Selaginella moellendorffii74622
Sorghum bicolorSb03g043150.1
Thellungiella halophilaThhalv10001962m
Vitis viniferaGSVIVT01015303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny