y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma05g36580.2
FamilyGH37
Protein PropertiesLength: 558 Molecular Weight: 63108.6 Isoelectric Point: 5.6554
ChromosomeChromosome/Scaffold: 05 Start: 40413636 End: 40418698
Descriptiontrehalase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH37365460
  DPKTYVDMPLKSALTVTEDAFQKLPRNANGSVPVEDLKRFIEAYFEGAGDDLVYRDPQDFVPEPEGFLPKVNQPQVRAWALQVHSLWKNLSRKISGAVKA
  QPDLHTLLPLPGSVVIPGSRFREVYYWDSYWVIRGLLASKMHDTAKAIVTNLISLIDKYGFVLNGARAYYTNRSQPPLLSAMIYEIYNSTGDLELVKRSL
  PALLKEYEFWNSDIHKLTILDAQGCTHTLNRYYAKWDKPRPESSIMDKASASNFSSVSEKQQFYRELASAAESGWDFSTRWMRNPPNFTTLATTSVIPVD
  LNAFLLGMELNIALFAKVTGDNSTAERFLENSDLRKKAMDSIFWNANKKQWLDYWLSSTCEEVHVWKNEHQNQNVFASNFVPLWMKPFYSDTSLVSSVVE
  SLKTSGLLRDAGVATSLTDSGQQWDFPNGWAPLQHMLVEGLLKSGLKEARLLAEEIAIRWVTTNYIVYKKTGVMHEKFDVEHCGEFGGGGEYVPQTGFGW
  SNGVVLAFLEE
Full Sequence
Protein Sequence     Length: 558     Download
MASHCVMAVT PSTPLLSFLE RLQETAFETF AHSNFDPKTY VDMPLKSALT VTEDAFQKLP    60
RNANGSVPVE DLKRFIEAYF EGAGDDLVYR DPQDFVPEPE GFLPKVNQPQ VRAWALQVHS    120
LWKNLSRKIS GAVKAQPDLH TLLPLPGSVV IPGSRFREVY YWDSYWVIRG LLASKMHDTA    180
KAIVTNLISL IDKYGFVLNG ARAYYTNRSQ PPLLSAMIYE IYNSTGDLEL VKRSLPALLK    240
EYEFWNSDIH KLTILDAQGC THTLNRYYAK WDKPRPESSI MDKASASNFS SVSEKQQFYR    300
ELASAAESGW DFSTRWMRNP PNFTTLATTS VIPVDLNAFL LGMELNIALF AKVTGDNSTA    360
ERFLENSDLR KKAMDSIFWN ANKKQWLDYW LSSTCEEVHV WKNEHQNQNV FASNFVPLWM    420
KPFYSDTSLV SSVVESLKTS GLLRDAGVAT SLTDSGQQWD FPNGWAPLQH MLVEGLLKSG    480
LKEARLLAEE IAIRWVTTNY IVYKKTGVMH EKFDVEHCGE FGGGGEYVPQ TGFGWSNGVV    540
LAFLEEFGWP EDRNIEC*                                                  600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13270treF6.0e-898550560+
PRK13271treA6.0e-9436545517+
COG1626TreA4.0e-1046553562+
PLN02567PLN0256709557554+
pfam01204Trehalase032548524+
Gene Ontology
GO TermDescription
GO:0004555alpha,alpha-trehalase activity
GO:0005991trehalose metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD22970.1015571557AF124148_1 trehalase 1 GMTRE1 [Glycine max]
RefSeqXP_002263698.1025576564PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303674.10955717568predicted protein [Populus trichocarpa]
RefSeqXP_002303675.10955717568predicted protein [Populus trichocarpa]
RefSeqXP_002518875.10955716567alpha,alpha-trehalase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wyn_D03654529500A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB2wyn_C03654529500A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB2wyn_B03654529500A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB2wyn_A03654529500A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB2jjb_D03654529500A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Metabolic Pathways
Pathway NameReactionECProtein Name
trehalose degradation II (trehalase)TREHALA-RXNEC-3.2.1.28α,α-trehalase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9856852273325580
CX7038062123445550
CX7035302123445550
CO9797402093505580
FQ4803532892585430
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00232.1Aquca_037_00231.2Aquca_037_00231.1
Arabidopsis lyrata914188
Arabidopsis thalianaAT4G24040.1
Brachypodium distachyonBradi3g31410.3Bradi3g31410.2Bradi3g31410.1
Brassica rapaBra013756Bra019249
Carica papayaevm.model.supercontig_15.13
Capsella rubellaCarubv10006565m
Chlamydomonas reinhardtiiCre03.g195600.t1.2.34.224Cre03.g195600.t1.2.34.224Cre03.g195600.t1.2.267.650Cre03.g195600.t1.2.267.650
Citrus clementinaCiclev10023271mCiclev10033306mCiclev10001132mCiclev10001012mCiclev10001134m
Ciclev10000621mCiclev10000674m
Citrus sinensisorange1.1g041103m.84.216orange1.1g037772m.219.456orange1.1g037772m.219.456orange1.1g047407morange1.1g041103m.217.446
orange1.1g041103m.217.446orange1.1g037772m.86.219orange1.1g037772m.86.219orange1.1g041103m.84.216
Cucumis sativusCucsa.303880.1
Eucalyptus grandisEucgr.E01027.1Eucgr.E01027.2
Fragaria vescamrna25101.1-v1.0-hybrid
Glycine maxGlyma05g36580.1
Gossypium raimondiiGorai.003G075200.1Gorai.007G020500.2Gorai.007G020500.1
Linum usitatissimumLus10023035Lus10032434Lus10023034Lus10032435
Malus domesticaMDP0000315187.328.541MDP0000235673.82.325MDP0000315187.82.325MDP0000315187.82.325MDP0000235673.82.325
MDP0000235673.328.541MDP0000315187.328.541MDP0000235673.328.541
Manihot esculentacassava4.1_015916mcassava4.1_004491mcassava4.1_023202m
Mimulus guttatusmgv1a003260m
Oryza sativaLOC_Os10g37660.1
Panicum virgatumPavirv00009281mPavirv00064436mPavirv00062867mPavirv00064435m
Physcomitrella patensPp1s196_77V6.1Pp1s194_104V6.3Pp1s116_30V6.1Pp1s194_104V6.2Pp1s194_104V6.1
Pp1s137_159V6.1
Phaseolus vulgarisPhvul.002G301500.2Phvul.002G301500.1
Picea abiesMA_31368g0020MA_31368g0010
Populus trichocarpaPotri.001G087100.1Potri.003G144000.1Potri.006G068300.1Potri.003G143900.1Potri.001G087100.2
Prunus persicappa003514m
Ricinus communis28842.m00094530068.m002541
Setaria italicaSi034760m
Selaginella moellendorffii90006177119156751109304
Sorghum bicolorSb01g031280.1
Thellungiella halophilaThhalv10024684m
Vitis viniferaGSVIVT01019610001
Volvox carteriVocar20003462m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny