y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g00230.1
FamilyGT13
Protein PropertiesLength: 445 Molecular Weight: 52060.3 Isoelectric Point: 6.5254
ChromosomeChromosome/Scaffold: 06 Start: 24557 End: 43462
Descriptionalpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, putative
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT13224360
  IQMRLFATQSEYADRLAAAIEAENHCTSQTRSLIDQISLQQGRIVALEEEQKRRDQECGQTKSLVQDLERKDLQRLIDKVQVPVAAVVIMACNRADYLER
  TINSVLKYQRPISSRYPLFVSQDGSNPNVKSKALSYDQLSYMQHLDFEPVQTERPGELTAYYKIARHYKWALDQLFYKHNFSRVIILEDDMEIAPDFFDY
  FEAAATLLDKDKSIMAVSSWNDNGQKQFVHDPYELYRSDFFPGLGWMLARSTWDELSPKWPKAYWDDWLRLKENHKGRQFIRPEVCRTYNFGEHGSSLGQ
  FFKQFLEPIKLNDVKVDWKSMDLSYLLEDKYSMHFANVVKKATPVYGADMVLKAYNIDGDVRIKYEDQSDFENIARQFGIFQEWKDGVPRTAYKGVVVFR
  YQTSRRIFLVGPEYL
Full Sequence
Protein Sequence     Length: 445     Download
MAKVFCDFRF LLLIAAGVFI YIQMRLFATQ SEYADRLAAA IEAENHCTSQ TRSLIDQISL    60
QQGRIVALEE EQKRRDQECG QTKSLVQDLE RKDLQRLIDK VQVPVAAVVI MACNRADYLE    120
RTINSVLKYQ RPISSRYPLF VSQDGSNPNV KSKALSYDQL SYMQHLDFEP VQTERPGELT    180
AYYKIARHYK WALDQLFYKH NFSRVIILED DMEIAPDFFD YFEAAATLLD KDKSIMAVSS    240
WNDNGQKQFV HDPYELYRSD FFPGLGWMLA RSTWDELSPK WPKAYWDDWL RLKENHKGRQ    300
FIRPEVCRTY NFGEHGSSLG QFFKQFLEPI KLNDVKVDWK SMDLSYLLED KYSMHFANVV    360
KKATPVYGAD MVLKAYNIDG DVRIKYEDQS DFENIARQFG IFQEWKDGVP RTAYKGVVVF    420
RYQTSRRIFL VGPEYLKLLQ IEES*                                          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13641Glyco_tranf_2_30.0007107325243+
cd00761Glyco_tranf_GTA_type6.0e-5108241134+
cd02514GT13_GLCNAC-TI6.0e-172105434335+
pfam03071GNT-I015433425+
Gene Ontology
GO TermDescription
GO:0000139Golgi membrane
GO:0003827alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0006487protein N-linked glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU18645.1013741374unknown [Glycine max]
EMBLCAC80697.1054446446N-acetylglucosaminyltransferase I [Solanum tuberosum]
EMBLCAC80702.1034445446N-acetylglucosaminyltransferase I [Nicotiana tabacum]
EMBLCBI29533.1014421439unnamed protein product [Vitis vinifera]
RefSeqNP_195537.2014441444CGL1 (COMPLEX GLYCAN LESS 1); alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase/ protein N-acetylglucosaminyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1foa_A01024345338A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB1fo9_A01024345338A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2apc_A01054342332A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2am5_A01054342332A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2am4_A01054342332A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
Transmembrane Domains
StartEnd
527
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BM77974527952830
EH7311532911524420
BM78005628052840
GO802527323293500
ES8416563041284290
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00911.3Aquca_007_00911.4Aquca_007_00911.2Aquca_007_00911.1Aquca_007_00911.5
Arabidopsis lyrata912565490588
Arabidopsis thalianaAT4G38240.1AT4G38240.2AT4G38240.3
Brachypodium distachyonBradi3g60820.3Bradi3g60820.1Bradi3g60820.2
Brassica rapaBra033557
Carica papayaevm.TU.contig_28580.1.22.235evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.22.235
Capsella rubellaCarubv10007540m
Citrus clementinaCiclev10028418m
Citrus sinensisorange1.1g019888morange1.1g012912morange1.1g012941m
Cucumis sativusCucsa.099720.1Cucsa.099720.2
Eucalyptus grandisEucgr.L00584.1Eucgr.L00583.1Eucgr.H04987.1Eucgr.H04987.2Eucgr.H04989.3
Eucgr.H04989.2Eucgr.H04989.4Eucgr.H04989.1
Fragaria vescamrna17328.1-v1.0-hybrid
Glycine maxGlyma04g00200.1
Gossypium raimondiiGorai.008G014000.2Gorai.008G014000.3Gorai.008G014000.1
Linum usitatissimumLus10022994Lus10001389
Malus domesticaMDP0000173465.283.435MDP0000170967.230.351MDP0000170967.22.209MDP0000170967.22.209MDP0000173465.283.435
MDP0000173465.22.268MDP0000173465.22.268MDP0000170967.230.351
Manihot esculentacassava4.1_024783m
Medicago truncatulaMedtr3g118520.1Medtr3g118520.2Medtr3g118520.3
Mimulus guttatusmgv1a006517mmgv1a006750m
Oryza sativaLOC_Os02g58590.1.304.426LOC_Os02g58590.1.304.426LOC_Os02g58590.1.22.283LOC_Os02g58590.1.22.283
Panicum virgatumPavirv00053907mPavirv00020030m
Physcomitrella patensPp1s100_54V6.1Pp1s246_61V6.1
Phaseolus vulgarisPhvul.009G115600.1
Picea abiesMA_901813g0010
Populus trichocarpaPotri.009G168000.2Potri.009G168000.1Potri.009G168000.4Potri.004G206900.3Potri.004G206900.1
Potri.004G206900.2Potri.009G168000.3
Prunus persicappa006221m
Ricinus communis29675.m000398.22.23129675.m000398.232.34829675.m000398.232.34829675.m000398.22.231
Setaria italicaSi006441mSi006440m
Selaginella moellendorffii268301
Sorghum bicolorSb08g003660.1
Thellungiella halophilaThhalv10025211mThhalv10025208mThhalv10025250m
Vitis viniferaGSVIVT01002028001GSVIVT01002907001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny