y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g02760.1
FamilyGH9
Protein PropertiesLength: 530 Molecular Weight: 57708.8 Isoelectric Point: 5.7921
ChromosomeChromosome/Scaffold: 06 Start: 1860812 End: 1866699
Descriptionglycosyl hydrolase 9B7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9585150
  YSTALKTAMQFFDVQKSGRLVDNKISWRGNSALKDGSQAKLDLSKGMYDAGDNMKFGFPMAFTATVLSWSILEYGDQMDHVGQLDAAQDSLKWITDFLIN
  AHPSENVLYIQVGDPVADHKCWEKPEAMTEERPLLQVNASCPGSDIAAETAAAMASASLVFKKTDPTYSSTLLKHAKQLFTFADKNRGSYSENIPEVATY
  YNSTGYGDELLWAASWLYHATGDDSYLQFVTGQDGEDYAQWGSPTWFSWDNKLAGTQVLLSRLSFFKAKDISNSYSSGLHSYRKTAEAVMCGLLPDSPTA
  TKSRTDDGLIWVSQWNSLQHPVASAFLAAVYSDYMLTSQTPKLKCDSDSFTPSDLRDFAKSQADYVLGKNPMHMSFLVGYGDKYPQFVHHRGASIPADAK
  TGCKDGFQWLESSDPNPNVATGALVGGPFLNETFIDSRNNSMQTEPSTYNSAVIVGLL
Full Sequence
Protein Sequence     Length: 530     Download
MGEKSRSKGG CCGWFIAFVI LALVVGAIVF TVKKKFSHSG SDKPAPVPGP PGAVDQKYST    60
ALKTAMQFFD VQKSGRLVDN KISWRGNSAL KDGSQAKLDL SKGMYDAGDN MKFGFPMAFT    120
ATVLSWSILE YGDQMDHVGQ LDAAQDSLKW ITDFLINAHP SENVLYIQVG DPVADHKCWE    180
KPEAMTEERP LLQVNASCPG SDIAAETAAA MASASLVFKK TDPTYSSTLL KHAKQLFTFA    240
DKNRGSYSEN IPEVATYYNS TGYGDELLWA ASWLYHATGD DSYLQFVTGQ DGEDYAQWGS    300
PTWFSWDNKL AGTQVLLSRL SFFKAKDISN SYSSGLHSYR KTAEAVMCGL LPDSPTATKS    360
RTDDGLIWVS QWNSLQHPVA SAFLAAVYSD YMLTSQTPKL KCDSDSFTPS DLRDFAKSQA    420
DYVLGKNPMH MSFLVGYGDK YPQFVHHRGA SIPADAKTGC KDGFQWLESS DPNPNVATGA    480
LVGGPFLNET FIDSRNNSMQ TEPSTYNSAV IVGLLSSLVT TSSAVQSFT*               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00119PLN001197.0e-14358509459+
PLN02340PLN023405.0e-14558504454+
PLN02171PLN021711.0e-14858509460+
pfam00759Glyco_hydro_91.0e-16958509456+
PLN02345PLN02345061511451+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF42037.103852938526cellulase2 [Pyrus communis]
RefSeqXP_002276739.104152938525PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300715.104152938523predicted protein [Populus trichocarpa]
RefSeqXP_002307711.105452951523predicted protein [Populus trichocarpa]
RefSeqXP_002510516.1015281522endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0585195429A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB1ksc_A0585195429A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB1ks8_A0585195429A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0575195441A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0575195441A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
1332
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7604532882185050
HO7820382972155110
GR2182823191935110
GR2182833191935110
DY2895473251714950
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00072.3Aquca_007_00072.2Aquca_007_00072.1
Arabidopsis lyrata472218895440
Arabidopsis thalianaAT1G75680.1AT1G19940.1
Brachypodium distachyonBradi4g36240.1Bradi1g35220.1
Brassica rapaBra025783Bra008214Bra015827Bra012198
Carica papayaevm.model.supercontig_26.31evm.model.supercontig_6.239
Capsella rubellaCarubv10020139mCarubv10008868m
Citrus clementinaCiclev10003402mCiclev10000849mCiclev10025306m
Citrus sinensisorange1.1g009846morange1.1g036398morange1.1g048736m
Cucumis sativusCucsa.342940.1
Eucalyptus grandisEucgr.I02356.1Eucgr.F01640.1
Fragaria vescamrna14858.1-v1.0-hybridmrna08501.1-v1.0-hybrid
Glycine maxGlyma02g05510.2Glyma02g05510.1Glyma04g02740.1Glyma16g23930.2
Gossypium raimondiiGorai.002G123700.1Gorai.009G195400.1Gorai.007G195700.1Gorai.010G005200.1Gorai.009G195400.2
Gorai.009G195400.3Gorai.009G195400.4
Linum usitatissimumLus10025965Lus10033156Lus10034515Lus10014265
Malus domesticaMDP0000140066.57.384MDP0000250849MDP0000140066.57.384MDP0000147635
Manihot esculentacassava4.1_005604mcassava4.1_005517mcassava4.1_005180mcassava4.1_021748m
Medicago truncatulaMedtr8g075990.1Medtr3g113720.1
Mimulus guttatusmgv1a004472mmgv1a004578m
Oryza sativaLOC_Os09g36350.2LOC_Os06g50140.1LOC_Os09g36350.1
Panicum virgatumPavirv00061954mPavirv00002469mPavirv00006523mPavirv00002468m
Physcomitrella patensPp1s308_21V6.1Pp1s60_116V6.1
Phaseolus vulgarisPhvul.009G016100.1Phvul.003G262600.1
Picea abiesMA_132273g0020
Populus trichocarpaPotri.005G115400.1Potri.005G237700.1Potri.002G023900.1
Ricinus communis30170.m01379027471.m000417
Setaria italicaSi006241mSi029476m
Selaginella moellendorffii77612144066
Sorghum bicolorSb10g030140.1Sb02g030990.1
Thellungiella halophilaThhalv10007364mThhalv10018397m
Vitis viniferaGSVIVT01018793001GSVIVT01009881001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny