y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g03220.1
FamilyGT4
Protein PropertiesLength: 465 Molecular Weight: 52016.9 Isoelectric Point: 10.2139
ChromosomeChromosome/Scaffold: 06 Start: 2262571 End: 2269084
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42684313.8e-22
  LLFAIINSVSRGKGQDLFLRSFYESLQLIQEKKLQLPFLHAVIVGSDMNAQTKFEMELRKFVVEKKIQNRVHFVNKTLAVAPYLAAIDVLVQNSQARGEC
  FGRITIEAMAFRLPVLGTAAGGTMEIVVNGTTGLLHPVGKEGVTPLAKNIVKLASHVEKRLTMG
Full Sequence
Protein Sequence     Length: 465     Download
MAKHSVAMAK KRWPIMLAAF LSVSTVTVLL MRSNNSDSCN TNHFTVAQDN QIRSPVQLTN    60
AASSPLIFMK SKLVLMVSHE LSLSGGPLLL MELAFLLRGV GSDVVWISNQ KPSEHDRVVY    120
SLESKMLDRG VQVLSAKGEN AIDTALKADM VILNTAVAGK WLDAILKEKV AHVLPKVLWW    180
IHEMRGHYFK VEYVKHLPFV AGAMIDSHTT AEYWKNRTRE RLGIEMPETY VVHLGNSKEL    240
MEVAEDSVAK RVLREHVRES LGVRNDDLLF AIINSVSRGK GQDLFLRSFY ESLQLIQEKK    300
LQLPFLHAVI VGSDMNAQTK FEMELRKFVV EKKIQNRVHF VNKTLAVAPY LAAIDVLVQN    360
SQARGECFGR ITIEAMAFRL PVLGTAAGGT MEIVVNGTTG LLHPVGKEGV TPLAKNIVKL    420
ASHVEKRLTM GKKGYERVKE RFLEHHMSQR IALVLKEVLQ KAKQ*                    480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0438RfaG6.0e-1969461409+
cd03819GT1_WavL_like1.0e-19249447200+
cd03798GT1_wlbH_like2.0e-20258458205+
cd03808GT1_cap1E_like4.0e-22280451174+
cd03801GT1_YqgM_like8.0e-3074456401+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU24642.103746239460unknown [Glycine max]
EMBLCAN73426.1014591470hypothetical protein [Vitis vinifera]
EMBLCBI19755.1014641459unnamed protein product [Vitis vinifera]
RefSeqXP_002281084.1014641475PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002510442.1014631476glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jjm_L0.0000000002334463265390A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_K0.0000000002334463265390A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_J0.0000000002334463265390A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_I0.0000000002334463265390A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_H0.0000000002334463265390A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Transmembrane Domains
StartEnd
1330
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7808963301364650
HO8056393271394650
DY2903883381034400
ES8320743341214500
GO869953331683980
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00577.1Aquca_001_00590.2Aquca_001_00590.1
Arabidopsis lyrata889408316473897892474368
Arabidopsis thalianaAT1G19710.1AT1G75420.1AT3G15940.2AT3G15940.1AT1G52420.1
Brachypodium distachyonBradi2g09620.1
Brassica rapaBra025759Bra027200Bra030384
Carica papayaevm.model.supercontig_99.5evm.model.supercontig_253.2
Capsella rubellaCarubv10020237mCarubv10011399mCarubv10013095m
Citrus clementinaCiclev10025538mCiclev10001031mCiclev10024994m
Citrus sinensisorange1.1g023290morange1.1g017123morange1.1g017085morange1.1g012132morange1.1g011954m
orange1.1g004942morange1.1g004760m
Cucumis sativusCucsa.105340.1Cucsa.300870.1
Eucalyptus grandisEucgr.F01601.1Eucgr.F03009.1Eucgr.J03011.1
Fragaria vescamrna15198.1-v1.0-hybridmrna14930.1-v1.0-hybridmrna05979.1-v1.0-hybrid
Glycine maxGlyma04g03170.1Glyma15g01640.6Glyma15g01640.5Glyma15g01640.4Glyma15g01640.3
Glyma08g22160.2Glyma07g03870.1Glyma13g43720.1
Gossypium raimondiiGorai.009G198800.1Gorai.003G012600.2Gorai.003G012600.1Gorai.007G199800.4Gorai.007G199800.3
Gorai.007G199800.1Gorai.009G132600.4Gorai.009G132600.3Gorai.009G132600.2Gorai.009G132600.1
Gorai.002G058400.1Gorai.011G077500.1
Linum usitatissimumLus10041786Lus10028338Lus10024281Lus10011469Lus10037523
Malus domesticaMDP0000210114MDP0000312093MDP0000064350MDP0000204168
Manihot esculentacassava4.1_006962mcassava4.1_006727mcassava4.1_002537m
Medicago truncatulaMedtr4g069840.1
Mimulus guttatusmgv1a005641mmgv1a002407m
Oryza sativaLOC_Os01g15780.1
Panicum virgatumPavirv00028369m
Physcomitrella patensPp1s24_249V6.3
Phaseolus vulgarisPhvul.009G060600.1Phvul.010G151400.1Phvul.005G172300.2Phvul.005G172300.1
Picea abiesMA_159042g1120
Populus trichocarpaPotri.005G118800.1Potri.002G031300.1Potri.001G179000.1Potri.001G179000.5
Prunus persicappa005334mppa005118mppa002059m
Ricinus communis30170.m01409429872.m00052635599.m00001450675.m000024
Setaria italicaSi002128m
Selaginella moellendorffii10326098243
Sorghum bicolorSb03g010200.1
Thellungiella halophilaThhalv10007567mThhalv10007509mThhalv10018489mThhalv10020188mThhalv10011288m
Thhalv10011286m
Vitis viniferaGSVIVT01009775001GSVIVT01018875001GSVIVT01017132001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)