y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g04600.2
FamilyCE6
Protein PropertiesLength: 312 Molecular Weight: 34393.6 Isoelectric Point: 6.8858
ChromosomeChromosome/Scaffold: 06 Start: 3265905 End: 3268420
DescriptionDomain of unknown function (DUF303)
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE61051992.8e-28
  GPGMAFANWVLEKHPEFGLIGLVPCAIGGSNISEWERGKELYNQMIKRAKASLRDGGTIRALLWYQGETDTVNLHDAQLYQTRVHKFFLDVRDDL
Full Sequence
Protein Sequence     Length: 312     Download
MSKVGQRGVL SENMPCLLLL LLFLIQAWPV KPQQAYDRNI FILAGQSNMA GRGGVVNNTA    60
TWDGVVSPQS RPNPSVLKLD AHLTWVAARE PLDADIDSAK TNGVGPGMAF ANWVLEKHPE    120
FGLIGLVPCA IGGSNISEWE RGKELYNQMI KRAKASLRDG GTIRALLWYQ GETDTVNLHD    180
AQLYQTRVHK FFLDVRDDLR SPLLPIIQVA LASGSGPYIE MVRQAQLGID LLNLRTVDAH    240
GLPLQPDGLH LSTPAQVHLG QMMADAFLQF VPSSNPNYNV SPILNEAIRL YNYAFYVNML    300
PLFSTMYPTF L*                                                        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03629DUF3032.0e-2340270276+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_190869.302530714284unknown protein [Arabidopsis thaliana]
RefSeqXP_002283036.103627325258PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002327179.103830323287predicted protein [Populus trichocarpa]
RefSeqXP_002510156.10182694259conserved hypothetical protein [Ricinus communis]
RefSeqXP_002510157.10162685256conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2apj_D02926818256A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB2apj_C02926818256A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB2apj_B02926818256A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB2apj_A02926818256A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB1zmb_F6e-20412865237A Chain A, Crystal Structure Of The Putative Acetylxylan Esterase From Clostridium Acetobutylicum, Northeast Structural Genomics Target Car6
Signal Peptide
Cleavage Site
32
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BU764097195152090
HO02339617521760
DY299093253262740
DY291778252262730
FG86700121332090
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00771.1Aquca_007_00771.2Aquca_083_00065.1Aquca_007_00769.2Aquca_007_00769.1
Aquca_083_00064.1
Arabidopsis lyrata491251485676
Arabidopsis thalianaAT4G34215.2AT4G34215.1AT3G53010.1
Brachypodium distachyonBradi1g00920.1Bradi5g01970.1Bradi5g03767.1
Brassica rapaBra019633Bra011507Bra006967
Carica papayaevm.model.supercontig_21.147evm.model.supercontig_106.87
Capsella rubellaCarubv10017718m
Citrus clementinaCiclev10029126mCiclev10001964m
Citrus sinensisorange1.1g031029morange1.1g041680m
Cucumis sativusCucsa.219410.1Cucsa.352550.1Cucsa.363600.1Cucsa.395900.1Cucsa.118670.1
Cucsa.131470.1Cucsa.395910.1
Eucalyptus grandisEucgr.F02296.1Eucgr.F02295.1Eucgr.F00179.1Eucgr.F02298.1Eucgr.H03219.1
Fragaria vescamrna26277.1-v1.0-hybridmrna00187.1-v1.0-hybridmrna00186.1-v1.0-hybrid
Glycine maxGlyma04g04480.1Glyma20g26520.1Glyma14g09520.2
Gossypium raimondiiGorai.009G215800.2Gorai.009G215800.1Gorai.009G276300.1Gorai.002G009200.3Gorai.002G009200.2
Gorai.002G009200.1Gorai.010G023400.1Gorai.010G023300.1
Linum usitatissimumLus10014097Lus10019817Lus10001129Lus10001128Lus10042634
Malus domesticaMDP0000268373MDP0000232743MDP0000659790
Manihot esculentacassava4.1_017032mcassava4.1_014751mcassava4.1_012755mcassava4.1_028741mcassava4.1_023715m
Medicago truncatulaMedtr3g102390.1Medtr1g018750.1Medtr4g031010.1
Mimulus guttatusmgv1a011596mmgv1a011640mmgv1a012327mmgv1a011466mmgv1a024902m
mgv1a012748m
Oryza sativaLOC_Os03g64030.1LOC_Os04g20810.3LOC_Os04g20810.2LOC_Os04g20810.1LOC_Os03g64050.1
LOC_Os04g01980.1
Panicum virgatumPavirv00050725mPavirv00054854mPavirv00001245mPavirv00015379mPavirv00041774m
Pavirv00024018mPavirv00052298m
Physcomitrella patensPp1s22_274V6.1
Phaseolus vulgarisPhvul.009G067900.1Phvul.007G040500.1Phvul.001G025100.1
Picea abiesMA_10266583g0010MA_10429498g0010
Populus trichocarpaPotri.001G300800.2Potri.001G300800.1Potri.009G096400.2Potri.009G096400.1Potri.014G022600.1
Potri.014G022700.2Potri.014G022700.1
Prunus persicappa018867mppa010380mppa015335m
Ricinus communis30170.m01421430170.m01378629801.m003105
Setaria italicaSi037070mSi018083mSi037046mSi018268mSi037217m
Si010984mSi010752m
Selaginella moellendorffii122285
Sorghum bicolorSb02g011020.1Sb01g000550.1Sb01g000530.1Sb06g006110.1Sb06g000860.1
Thellungiella halophilaThhalv10026018mThhalv10010602m
Vitis viniferaGSVIVT01003163001GSVIVT01009426001GSVIVT01009427001
Zea maysAC203966.5_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)