y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g06350.1
FamilyAA2
Protein PropertiesLength: 327 Molecular Weight: 35251 Isoelectric Point: 5.1767
ChromosomeChromosome/Scaffold: 06 Start: 4551848 End: 4554259
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2533090
  STDPTIPGKLLRLVFHDCFVEGCDASLMLQGNNTEQSDPGNRSVGGFTVIDSAKRILEKFCPGTVSCADIIALAARDAVEIAGGPRTMIPTGRRDGMVSV
  ASNVRPNIVDTSFSMDEMVKLFASKGLSLLDLVILSGAHTIGTAHCSSFRDRFQEDSKGKLRLIDKTLNSDYANELIKQCPAGVQPSVTVNNDPETSMAF
  DNMYYQNLLAHKGLFQSDSVLISNDSTRKLVVDFANDQELFFENWDQSFLKLTSVGV
Full Sequence
Protein Sequence     Length: 327     Download
METRTGTLSI TVCSLVMFSF VSLVKGSLSF NFYAASCPSA ESIIRNIVSS SSSTDPTIPG    60
KLLRLVFHDC FVEGCDASLM LQGNNTEQSD PGNRSVGGFT VIDSAKRILE KFCPGTVSCA    120
DIIALAARDA VEIAGGPRTM IPTGRRDGMV SVASNVRPNI VDTSFSMDEM VKLFASKGLS    180
LLDLVILSGA HTIGTAHCSS FRDRFQEDSK GKLRLIDKTL NSDYANELIK QCPAGVQPSV    240
TVNNDPETSM AFDNMYYQNL LAHKGLFQSD SVLISNDSTR KLVVDFANDQ ELFFENWDQS    300
FLKLTSVGVK TGDKGEIRIS CASTNA*                                        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase5.0e-625828932+
cd00691ascorbate_peroxidase8.0e-2362310274+
pfam00141peroxidase1.0e-5744193151+
PLN03030PLN030305.0e-7432325301+
cd00693secretory_peroxidase1.0e-14928321297+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ11760.101532520332class III peroxidase [Gossypium hirsutum]
RefSeqXP_002285587.1013261329PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002309694.101232614332predicted protein [Populus trichocarpa]
RefSeqXP_002324930.101232614334predicted protein [Populus trichocarpa]
RefSeqXP_002515390.1034326468760RNA lariat debranching enzyme, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A0283262304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1qo4_A0283263305A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1pa2_A0283263305A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB4a5g_B0263262306A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB4a5g_A0263262306A Chain A, Raphanus Sativus Anionic Peroxidase.
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Transmembrane Domains
StartEnd
724
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CV245011261673270
GW88861423312330
CV529734253132650
FQ462171254282810
FY45950723722380
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00365.1
Arabidopsis lyrata328551481340
Arabidopsis thalianaAT4G31760.1AT2G24800.1
Brachypodium distachyonBradi5g14650.1
Brassica rapaBra007831
Capsella rubellaCarubv10006533mCarubv10025481m
Citrus clementinaCiclev10008792m
Citrus sinensisorange1.1g019972m
Cucumis sativusCucsa.271330.1
Eucalyptus grandisEucgr.C04029.1
Fragaria vescamrna14987.1-v1.0-hybrid
Glycine maxGlyma17g33730.2Glyma14g12170.1
Gossypium raimondiiGorai.001G039200.1Gorai.009G064700.2Gorai.009G064700.1Gorai.001G039200.2
Linum usitatissimumLus10026903Lus10020097
Malus domesticaMDP0000289293
Manihot esculentacassava4.1_011556m
Medicago truncatulaMedtr3g105790.1
Mimulus guttatusmgv1a021862m
Panicum virgatumPavirv00013823mPavirv00002787m
Phaseolus vulgarisPhvul.009G085800.1Phvul.001G043100.2Phvul.001G043100.1
Populus trichocarpaPotri.018G015500.1Potri.006G267400.1
Prunus persicappa025451m
Ricinus communis29848.m004502
Setaria italicaSi011734m
Selaginella moellendorffii106106
Sorghum bicolorSb06g021550.1
Thellungiella halophilaThhalv10025685mThhalv10000495m
Vitis viniferaGSVIVT01036009001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny