y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g12970.3
FamilyGT31
Protein PropertiesLength: 344 Molecular Weight: 38625 Isoelectric Point: 8.8772
ChromosomeChromosome/Scaffold: 06 Start: 10117211 End: 10122851
DescriptionGalactosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT311303250
  NRDAIRKAWMGSGASLKKIEEGKGIIVRFVIGRSENRGDSQDKDIDHENRLTNDFLILDNHVETNDAFPKKVKLFFAHAADKWDAEFYAKVNDDVYVNID
  ALGATLATHLDKPRVYMGCMKSGEVFSELNHKWYEPEWWKFGDKKSYFRHASGEMYVISRALAKFISINRSILRTYAHDDVSAGSWFIGLDVKHVD
Full Sequence
Protein Sequence     Length: 344     Download
MQSRGSSHRV SSMGNNRSRI PALLISMFAA FASIYVAGRL WLDAENRVYL IKELDRITGQ    60
GQSAISVDDT LKIIACREQH KKLDALETEL AGARQEGFVS NPLIETNGTY STRRPLVVIG    120
ILTKFGRQKN RDAIRKAWMG SGASLKKIEE GKGIIVRFVI GRSENRGDSQ DKDIDHENRL    180
TNDFLILDNH VETNDAFPKK VKLFFAHAAD KWDAEFYAKV NDDVYVNIDA LGATLATHLD    240
KPRVYMGCMK SGEVFSELNH KWYEPEWWKF GDKKSYFRHA SGEMYVISRA LAKFISINRS    300
ILRTYAHDDV SAGSWFIGLD VKHVDEAKFC CSSWSTGAIC AGV*                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03133PLN031330.0005111341256+
pfam13334DUF40943.0e-14189691+
pfam01762Galactosyl_T2.0e-35131325201+
PLN03193PLN031935.0e-8881340274+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008378galactosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAD30015.1013421342beta 1,3-glycosyltransferase-like protein I [Solanum lycopersicum]
RefSeqXP_002303622.101834319344predicted protein [Populus trichocarpa]
RefSeqXP_002331850.1063409343predicted protein [Populus trichocarpa]
RefSeqXP_002444279.101134314346hypothetical protein SORBIDRAFT_07g019420 [Sorghum bicolor]
RefSeqXP_002513605.1033437346Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Transmembrane Domains
StartEnd
2042
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79671533693440
HO786251320253440
DY943009302173180
FF5467742321133440
EX266995303243260
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00268.1Aquca_052_00007.5Aquca_052_00007.4Aquca_052_00007.2Aquca_052_00007.1
Aquca_119_00001.1Aquca_005_00031.4Aquca_005_00031.3Aquca_005_00031.2Aquca_052_00007.3
Aquca_005_00031.1Aquca_037_00268.2Aquca_014_00028.1Aquca_013_00208.9Aquca_013_00208.7
Aquca_013_00208.4Aquca_013_00208.3Aquca_013_00208.10Aquca_013_00208.5Aquca_013_00208.6
Aquca_089_00021.2Aquca_089_00021.1Aquca_013_00208.8Aquca_013_00208.2Aquca_013_00208.1
Aquca_013_00208.11
Arabidopsis lyrata476947311603473475492104902296
313884472435879419495407901160
491522891474
Arabidopsis thalianaAT1G77810.2AT1G77810.1AT1G05170.2AT1G05170.1AT1G32930.1
AT2G32430.1AT1G33430.1AT4G26940.1AT1G11730.1AT1G33430.2
AT1G22015.1AT5G53340.2AT5G53340.1AT4G26940.2AT4G32120.1
AT2G25300.1
Brachypodium distachyonBradi3g46390.1Bradi1g15590.1Bradi2g24700.1Bradi2g56700.1Bradi4g31890.1
Bradi3g04860.1Bradi1g32726.1Bradi3g13770.1Bradi3g34830.1Bradi1g47860.1
Bradi1g47860.2Bradi3g34830.2
Brassica rapaBra015654Bra023296Bra015395Bra010422Bra005595
Bra010198Bra031357Bra012302Bra019835Bra016393
Bra019081Bra022647Bra003064Bra007804Bra011324
Carica papayaevm.model.supercontig_37.101evm.model.supercontig_828.1evm.TU.contig_30133.1evm.model.supercontig_12.295evm.model.supercontig_152.19
evm.model.supercontig_87.79evm.model.supercontig_187.4evm.model.supercontig_3.36evm.model.supercontig_122.23
Capsella rubellaCarubv10021555mCarubv10009858mCarubv10009358mCarubv10023330mCarubv10011446m
Carubv10009427mCarubv10012254mCarubv10028370mCarubv10023545mCarubv10005329m
Carubv10005570m
Citrus clementinaCiclev10021252mCiclev10020627mCiclev10008974mCiclev10008486mCiclev10008439m
Ciclev10001410mCiclev10001364mCiclev10016077mCiclev10015443mCiclev10024512m
Ciclev10015822mCiclev10015441mCiclev10023591mCiclev10022072mCiclev10001882m
Ciclev10001880mCiclev10021436mCiclev10024325mCiclev10005350mCiclev10005349m
Ciclev10005228mCiclev10008816mCiclev10020783m
Citrus sinensisorange1.1g022275morange1.1g017533morange1.1g016121morange1.1g015683morange1.1g021312m
orange1.1g017688morange1.1g015471morange1.1g015419morange1.1g022071morange1.1g015562m
orange1.1g015521morange1.1g015407morange1.1g021108morange1.1g018257morange1.1g016036m
orange1.1g015962morange1.1g021105morange1.1g021079morange1.1g026972morange1.1g021371m
orange1.1g045376morange1.1g024633morange1.1g024623morange1.1g025192morange1.1g024690m
orange1.1g019371morange1.1g019358morange1.1g019355morange1.1g017892morange1.1g023951m
orange1.1g023904morange1.1g044720morange1.1g024278morange1.1g024244morange1.1g024236m
orange1.1g024273morange1.1g019083morange1.1g016756morange1.1g024324morange1.1g024861m
orange1.1g029327morange1.1g025375m
Cucumis sativusCucsa.193380.3Cucsa.193380.1Cucsa.060060.4Cucsa.060060.2Cucsa.060060.1
Cucsa.274640.2Cucsa.274640.1Cucsa.148570.1Cucsa.154570.1Cucsa.072690.1
Cucsa.237810.1Cucsa.045210.1Cucsa.085780.1Cucsa.193380.2Cucsa.201890.8
Cucsa.201890.7Cucsa.201890.4Cucsa.201890.3Cucsa.201890.2Cucsa.201890.1
Cucsa.162560.4Cucsa.162560.1Cucsa.162560.3Cucsa.162560.2Cucsa.201890.5
Eucalyptus grandisEucgr.F03473.2Eucgr.F03473.1Eucgr.D01657.1Eucgr.F03738.5Eucgr.F03738.4
Eucgr.F03738.3Eucgr.F03738.2Eucgr.F03738.1Eucgr.A01123.2Eucgr.A01123.1
Eucgr.F04094.1Eucgr.K00317.1Eucgr.C01711.2Eucgr.A01123.3Eucgr.C01711.1
Fragaria vescamrna23782.1-v1.0-hybridmrna02238.1-v1.0-hybridmrna03345.1-v1.0-hybridmrna01864.1-v1.0-hybridmrna19626.1-v1.0-hybrid
mrna31179.1-v1.0-hybridmrna11602.1-v1.0-hybridmrna13123.1-v1.0-hybridmrna32019.1-v1.0-hybrid
Glycine maxGlyma14g33700.1Glyma13g02420.1Glyma06g46230.1Glyma04g43340.2Glyma04g43340.1
Glyma12g10520.1Glyma06g11330.1Glyma13g38500.1Glyma12g31980.3Glyma12g31980.1
Glyma09g36830.1Glyma09g36830.2Glyma12g00530.3Glyma12g00530.2Glyma17g01660.1
Glyma07g39070.2Glyma06g12970.1Glyma04g41810.2Glyma04g41810.1Glyma11g02170.1
Glyma14g14000.2Glyma14g14000.1Glyma17g32180.1Glyma11g02170.2
Gossypium raimondiiGorai.008G260300.3Gorai.008G260300.2Gorai.008G260300.1Gorai.010G046600.3Gorai.010G046600.2
Gorai.010G046600.1Gorai.013G101400.3Gorai.013G101400.2Gorai.013G101400.1Gorai.009G178900.6
Gorai.009G178900.2Gorai.011G013600.3Gorai.011G013600.2Gorai.011G013600.1Gorai.002G089700.4
Gorai.002G089700.3Gorai.002G089700.2Gorai.002G089700.1Gorai.009G440200.5Gorai.009G440200.4
Gorai.009G440200.2Gorai.009G440200.1Gorai.009G242100.1Gorai.006G204700.3Gorai.006G204700.2
Gorai.004G268200.1Gorai.006G204700.1Gorai.008G260300.4Gorai.013G101400.4Gorai.009G178900.3
Gorai.009G178900.1Gorai.005G149400.1Gorai.006G208900.2Gorai.006G208900.1Gorai.008G260300.5
Gorai.003G156200.1Gorai.007G014300.3Gorai.007G014300.2Gorai.007G014300.1Gorai.003G156200.2
Gorai.009G178900.5Gorai.004G292900.1Gorai.009G440200.3Gorai.010G116400.1Gorai.006G208900.3
Gorai.003G156200.3Gorai.009G178900.4
Linum usitatissimumLus10033248Lus10008282Lus10006933Lus10015107Lus10024750
Lus10031567Lus10040062Lus10020042Lus10027185Lus10039657
Lus10021538Lus10006782Lus10014945Lus10033935Lus10032350
Lus10002079Lus10001920Lus10001954Lus10038830Lus10001148
Malus domesticaMDP0000240682MDP0000015509MDP0000035633MDP0000149719MDP0000218946
MDP0000149254MDP0000106455MDP0000261248MDP0000305586MDP0000208103
MDP0000308911MDP0000279453MDP0000239688MDP0000254082MDP0000189111
MDP0000295772
Manihot esculentacassava4.1_008981mcassava4.1_009223mcassava4.1_009122mcassava4.1_008975mcassava4.1_008889m
cassava4.1_008886mcassava4.1_020961mcassava4.1_008793mcassava4.1_009046mcassava4.1_023087m
cassava4.1_009765mcassava4.1_012092mcassava4.1_010843mcassava4.1_011127mcassava4.1_011052m
cassava4.1_026632m
Medicago truncatulaMedtr3g073370.2Medtr3g073370.1Medtr2g088270.1Medtr4g035490.1Medtr5g009700.1
Medtr3g090600.1
Mimulus guttatusmgv1a007764mmgv1a007777mmgv1a007633mmgv1a007611mmgv1a007546m
mgv1a010231mmgv1a007921mmgv1a007366mmgv1a007738mmgv1a022857m
mgv1a009438mmgv1a019923mmgv1a009462m
Oryza sativaLOC_Os02g35870.2LOC_Os02g35870.1LOC_Os03g38050.1LOC_Os05g35266.2LOC_Os05g35266.1
LOC_Os09g27950.1LOC_Os01g65590.1LOC_Os02g06840.2LOC_Os02g06840.1LOC_Os06g46570.1
LOC_Os05g35266.3LOC_Os08g02370.1LOC_Os06g46570.2LOC_Os06g08005.1LOC_Os06g07905.2
LOC_Os06g07905.1LOC_Os08g29710.1
Panicum virgatumPavirv00056263mPavirv00039040mPavirv00011841mPavirv00035055mPavirv00025409m
Pavirv00059983mPavirv00051384mPavirv00055546mPavirv00049885mPavirv00062381m
Pavirv00026047mPavirv00017954mPavirv00041862mPavirv00030978mPavirv00038080m
Pavirv00041360mPavirv00062245mPavirv00062244mPavirv00017057mPavirv00017056m
Pavirv00004705mPavirv00025430mPavirv00064281mPavirv00048231m
Physcomitrella patensPp1s14_287V6.1Pp1s263_32V6.1Pp1s313_21V6.2Pp1s313_21V6.1Pp1s34_154V6.1
Pp1s101_254V6.1Pp1s101_254V6.2Pp1s152_167V6.1
Phaseolus vulgarisPhvul.009G026100.1Phvul.008G168500.1Phvul.011G103400.1Phvul.003G079100.1Phvul.011G003800.1
Phvul.005G115300.1Phvul.002G162100.1Phvul.009G136600.1Phvul.008G159800.1Phvul.001G049900.1
Phvul.008G133000.1
Picea abiesMA_90472g0010MA_11862g0010MA_8772058g0010MA_4402g0010MA_95800g0010
MA_10431213g0010
Populus trichocarpaPotri.002G089800.5Potri.002G089800.4Potri.002G089800.3Potri.002G089800.2Potri.002G089800.1
Potri.001G450200.2Potri.001G450200.1Potri.014G153700.4Potri.014G153700.3Potri.014G153700.2
Potri.014G153700.1Potri.011G004200.2Potri.011G004200.1Potri.005G171400.3Potri.005G171400.2
Potri.005G171400.1Potri.004G013900.3Potri.004G013900.2Potri.004G013900.1Potri.002G228900.8
Potri.002G228900.7Potri.002G228900.6Potri.002G228900.5Potri.002G228900.4Potri.002G228900.3
Potri.002G228900.1Potri.011G151400.1Potri.019G067300.2Potri.019G067300.1Potri.001G450200.3
Potri.002G228900.2Potri.002G228900.9Potri.003G136000.4Potri.003G136000.3Potri.003G136000.2
Potri.003G136000.1Potri.015G023700.2Potri.015G023700.1Potri.006G257200.3Potri.006G257200.2
Potri.006G257200.1Potri.004G013900.4Potri.018G024500.1Potri.018G024500.2
Prunus persicappa006755mppa006589mppa006612mppa006585mppa006530m
ppa023844mppa006626mppa008209mppa008186mppa008155m
Ricinus communis30068.m00260229908.m00595130169.m00645729600.m00056029842.m003586
30064.m00047930190.m01078630169.m00655029848.m004592
Setaria italicaSi017427mSi024836mSi000109mSi030564mSi030109m
Si006587mSi036099mSi017574mSi017391mSi013912m
Si007976mSi014017mSi014098m
Selaginella moellendorffii23245726716442743223325065231
9757481097
Sorghum bicolorSb04g023470.1Sb02g026360.1Sb01g015960.1Sb03g041540.1Sb09g021080.1
Sb10g027290.1Sb04g004400.1Sb07g001590.1Sb10g005160.1Sb07g019420.1
Sb10g005140.1
Thellungiella halophilaThhalv10007787mThhalv10007803mThhalv10018693mThhalv10025360mThhalv10007836m
Thhalv10009382mThhalv10023983mThhalv10016736mThhalv10007904mThhalv10014038m
Thhalv10000224mThhalv10025629mThhalv10014381m
Vitis viniferaGSVIVT01008948001GSVIVT01037664001GSVIVT01022413001GSVIVT01019685001GSVIVT01012721001
GSVIVT01037121001GSVIVT01030428001GSVIVT01019479001GSVIVT01028724001GSVIVT01035952001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)