y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g14270.2
FamilyAA2
Protein PropertiesLength: 231 Molecular Weight: 24945.1 Isoelectric Point: 5.9981
ChromosomeChromosome/Scaffold: 06 Start: 11232289 End: 11233425
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA26849.6e-22
  AAGLVRMHFHDYFIRGCDASVLLDSTSTNTAEKDSPANKPSLRGYEVNDNAKAKLEAVCPGIVSCADIVAFAARDSVEF
Full Sequence
Protein Sequence     Length: 231     Download
CISMIAAGLV RMHFHDYFIR GCDASVLLDS TSTNTAEKDS PANKPSLRGY EVNDNAKAKL    60
EAVCPGIVSC ADIVAFAARD SVEFIRAHTI GRSHCWAFSS RLYNFSSTSS QDPSLDPSYA    120
ALLKRQCPQG STNPNLVIPM NPSSPGIADV AYYVDILANR GPFTSDQTLL TDAETASQVK    180
QNARDPYLWA SQFADAMIKM GQISVITGNA GEIRTNCRVV NGEGLEYLHQ *             240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like2.0e-135202250+
pfam00141peroxidase3.0e-365185186+
PLN03030PLN030309.0e-495221275+
cd00693secretory_peroxidase8.0e-1115220269+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF63024.10522161331AF244921_1 peroxidase prx12 precursor [Spinacia oleracea]
GenBankACU20835.10522156326unknown [Glycine max]
DDBJBAA77387.10322249322peroxidase 1 [Scutellaria baicalensis]
RefSeqXP_002317837.10522158328predicted protein [Populus trichocarpa]
RefSeqXP_002321949.10522120290predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A0322130303A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1sch_B0522132294A Chain A, Peanut Peroxidase
PDB1sch_A0522132294A Chain A, Peanut Peroxidase
PDB1qo4_A0522333306A Chain A, Peanut Peroxidase
PDB1pa2_A0522333306A Chain A, Arabidopsis Thaliana Peroxidase A2
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF398626237392210
CV435116252232210
DW09360625852090
DW13408725852090
BU082862204542030
Orthologous Group
SpeciesID
Citrus clementinaCiclev10017508m
Malus domesticaMDP0000137752MDP0000161980
Phaseolus vulgarisPhvul.003G108100.1
Picea abiesMA_91294g0020MA_34380g0010
Ricinus communis29764.m000744
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny