y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g15140.1
FamilyGH77
Protein PropertiesLength: 569 Molecular Weight: 63987.6 Isoelectric Point: 5.7996
ChromosomeChromosome/Scaffold: 06 Start: 11916437 End: 11923076
Descriptiondisproportionating enzyme
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH77765570
  LHPTSFRGPYGIGDLGDEAFRFIDWLHHSGCSVWQVLPLVPPGRKANEEGSPYSGQDANCGNTLLISLQGLVEDGLLEKHELPQPIDAERVNFSLVADVK
  DPLITKAAERLISSEGELKTQLENFRRDPDISSWLEDAAYFAAIDDSLNTISWYNWPEPLRNRHLVALEDIYQQKRDFINVFIAQQFLFQRQWQKVHSYA
  QSKGISIMGDMPIYVGYHSADVWANKKQFLLNRKGFPLLVSGVPPDAFSETGQLWGSPLYDWKAMEKDGYSWWVRRIRRAQNLFDEFRIDHFRGFAGYWA
  VPSEAKVAMLGKWKVGPGISLFDTIFRAVGRINIIAEDLGVITEDVVQLRRSIGAPGMAVLQFGFGGDANNPHLPHNHECNQVVYTGTHDNDTIGGWWEV
  LNQEEKSNVLRYLSLNEGDDIPWALIQRVLASVAQTAIIPMQDVLGLGNSARMNIPATQFGNWGWRIASSVSFDGLEREADR
Full Sequence
Protein Sequence     Length: 569     Download
MALLALNISV CCFQQQRSPT LFKPTITKQT LSLPTASAFS SSSLTQLSVG QYLPANYGDW    60
VPNPDPELRR RCGILLHPTS FRGPYGIGDL GDEAFRFIDW LHHSGCSVWQ VLPLVPPGRK    120
ANEEGSPYSG QDANCGNTLL ISLQGLVEDG LLEKHELPQP IDAERVNFSL VADVKDPLIT    180
KAAERLISSE GELKTQLENF RRDPDISSWL EDAAYFAAID DSLNTISWYN WPEPLRNRHL    240
VALEDIYQQK RDFINVFIAQ QFLFQRQWQK VHSYAQSKGI SIMGDMPIYV GYHSADVWAN    300
KKQFLLNRKG FPLLVSGVPP DAFSETGQLW GSPLYDWKAM EKDGYSWWVR RIRRAQNLFD    360
EFRIDHFRGF AGYWAVPSEA KVAMLGKWKV GPGISLFDTI FRAVGRINII AEDLGVITED    420
VVQLRRSIGA PGMAVLQFGF GGDANNPHLP HNHECNQVVY TGTHDNDTIG GWWEVLNQEE    480
KSNVLRYLSL NEGDDIPWAL IQRVLASVAQ TAIIPMQDVL GLGNSARMNI PATQFGNWGW    540
RIASSVSFDG LEREADRLRE MLSMYGRL*                                      600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00217malQ1.0e-11368567510+
COG1640MalQ1.0e-13468567516+
PLN02635PLN02635050568519+
PRK14508PRK14508068568504+
pfam02446Glyco_hydro_77076549490+
Gene Ontology
GO TermDescription
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1X1N0485684524A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
EMBLCBI21503.104856865585unnamed protein product [Vitis vinifera]
Swiss-ProtQ0680102456832576DPEP_SOLTU RecName: Full=4-alpha-glucanotransferase, chloroplastic/amyloplastic; AltName: Full=Amylomaltase; AltName: Full=Disproportionating enzyme; Short=D-enzyme; Flags: Precursor
RefSeqXP_002276109.104856863583PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310024.10756820574predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1x1n_A0485684524A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB1fp9_A0675422477A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB1fp8_A0675422477A Chain A, Structure Of The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212
PDB2owx_A0675425480A Chain A, Structure Of The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212
PDB2oww_A0675425480A Chain A, Structure Of The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-1828EC-2.4.1.254-α-glucanotransferase
starch degradation IIRXN-12391EC-2.4.1.254-α-glucanotransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO435035479905670
DY280898293503420
ES816215286993840
ES8050872982665630
ES816215373814170.00004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00493.1Aquca_014_00493.2Aquca_009_00054.2Aquca_009_00054.1Aquca_009_00054.3.267.859
Arabidopsis lyrata496706483146
Arabidopsis thalianaAT5G64860.1AT2G40840.1
Brachypodium distachyonBradi1g20790.1Bradi1g18650.1.259.907
Brassica rapaBra037799Bra004590
Carica papayaevm.model.supercontig_196.11evm.model.supercontig_92.60
Capsella rubellaCarubv10026154mCarubv10022587m
Chlamydomonas reinhardtiiCre03.g181500.t1.2g1899.t1
Citrus clementinaCiclev10025236mCiclev10025748mCiclev10025303m.221.544Ciclev10025303m.221.544Ciclev10025303m.94.221
Ciclev10025303m.94.221Ciclev10010989m.279.926
Citrus sinensisorange1.1g007886morange1.1g009906morange1.1g002052m.279.926orange1.1g002050m.279.926orange1.1g002027m.279.929
Cucumis sativusCucsa.250500.2Cucsa.250500.1Cucsa.250500.10
Eucalyptus grandisEucgr.I00325.1Eucgr.K01679.1.272.918
Fragaria vescamrna31442.1-v1.0-hybridmrna31443.1-v1.0-hybridmrna00258.1-v1.0-hybrid.543.676mrna00258.1-v1.0-hybrid.543.676
Glycine maxGlyma04g39730.1Glyma03g27600.1.272.920Glyma19g30580.1.272.920
Gossypium raimondiiGorai.003G047100.1Gorai.003G047100.2Gorai.003G047100.3Gorai.003G047100.4Gorai.010G128900.7.272.586
Gorai.010G128900.6.272.586Gorai.010G128900.3Gorai.010G128900.5Gorai.010G128900.4Gorai.010G128900.2
Gorai.010G128900.1
Linum usitatissimumLus10035845Lus10036626Lus10035408.186.791Lus10031010.709.828Lus10031010.709.828
Lus10031010.709.828Lus10031010.348.710Lus10031010.348.710Lus10031010.348.710Lus10031010.186.329
Lus10031010.186.329Lus10031010.186.329
Malus domesticaMDP0000243418.304.467MDP0000243418.304.467MDP0000243418.154.302MDP0000243418.154.302MDP0000149290.248.921
Manihot esculentacassava4.1_008552mcassava4.1_001086m.256.903
Medicago truncatulaMedtr3g094840.1Medtr7g088740.3Medtr7g088740.1.278.801Medtr7g088740.1.278.801Medtr7g088740.2.57.569
Medtr7g088740.2.57.569Medtr7g088740.2.581.734Medtr7g088740.2.581.734Medtr7g088740.1.813.966Medtr7g088740.1.813.966
Mimulus guttatusmgv1a004209m.70.300mgv1a004209m.70.300mgv1a004209m.302.523mgv1a004209m.302.523mgv1a000923m.250.897
Oryza sativaLOC_Os07g43390.1LOC_Os07g46790.1.269.917
Panicum virgatumPavirv00011352mPavirv00008161mPavirv00039603mPavirv00069371m.297.611Pavirv00070133m
Pavirv00069370m.297.826Pavirv00069369m.272.920
Physcomitrella patensPp1s44_268V6.1Pp1s117_77V6.1Pp1s8_30V6.1Pp1s253_27V6.1
Phaseolus vulgarisPhvul.009G139500.1Phvul.001G117700.1
Picea abiesMA_10429341g0010MA_225933g0010MA_1108864g0010MA_10433631g0010MA_10432229g0010
Populus trichocarpaPotri.007G081400.1Potri.006G031700.4Potri.016G028900.3Potri.016G028900.2Potri.016G028900.1
Potri.006G031700.3Potri.006G031700.2Potri.006G031700.1
Prunus persicappa003327mppa011408mppa000782m.305.951
Ricinus communis29719.m00033330045.m000475.200.845
Setaria italicaSi029329mSi034110m.272.920Si028900m.276.863Si028839m.276.923
Selaginella moellendorffii109836444105427302268243
Sorghum bicolorSb02g040000.1Sb02g042100.1.268.916
Thellungiella halophilaThhalv10003902mThhalv10016195m
Vitis viniferaGSVIVT01022223001GSVIVT01025810001.273.921
Volvox carteriVocar20008073mVocar20014639m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)