y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g15940.1
FamilyGH28
Protein PropertiesLength: 478 Molecular Weight: 52352.4 Isoelectric Point: 7.7859
ChromosomeChromosome/Scaffold: 06 Start: 12518453 End: 12522784
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH281054510
  QNRGGAQLNIPTGTWLTGSFNLTSNFTLFLHHGAVILASQDPKEWPIIEPLPSYGRGRERLGGRHISLIHGNGISNVVITGQNGTVDGQGRMWWELWWNR
  TLEHTRGHLLELISSDNVLISNLTFRNSPFWTIHPVYCSNVVVKGMTILAPLNAPNTDGIDPDSSTNVCIEDNYIESGDDLVAIKSGWDHYGITMAHPST
  NIIVRRISGTTPTCSGVGIGSEMSGGISNITIENLHVWDSAAGVRIKSDKGRGGYITNVSISDIRMERVKIPIRFSRGSNDHPDDGWDPKAVPRFKDILI
  SNVVSVNSTKAPVLEGVEGSSFEGLCFKNITLHGVALSARWRCEYVS
Full Sequence
Protein Sequence     Length: 478     Download
MESGKTTFGA VVLGTCTRPS WALIFLLFTL VTFLTLHLPA RPVWFLSGLQ PGPYPTTTPT    60
CAGFFRDVPP RKVVLSIEDF GGVGDGKTSN TESFRRAIRY MQRFQNRGGA QLNIPTGTWL    120
TGSFNLTSNF TLFLHHGAVI LASQDPKEWP IIEPLPSYGR GRERLGGRHI SLIHGNGISN    180
VVITGQNGTV DGQGRMWWEL WWNRTLEHTR GHLLELISSD NVLISNLTFR NSPFWTIHPV    240
YCSNVVVKGM TILAPLNAPN TDGIDPDSST NVCIEDNYIE SGDDLVAIKS GWDHYGITMA    300
HPSTNIIVRR ISGTTPTCSG VGIGSEMSGG ISNITIENLH VWDSAAGVRI KSDKGRGGYI    360
TNVSISDIRM ERVKIPIRFS RGSNDHPDDG WDPKAVPRFK DILISNVVSV NSTKAPVLEG    420
VEGSSFEGLC FKNITLHGVA LSARWRCEYV SGFATEVFPV PCPELRNNSY SSWCSAS*      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02793PLN027932.0e-2169377328+
PLN03003PLN030036.0e-2564472442+
PLN02218PLN022188.0e-2775438389+
pfam00295Glyco_hydro_282.0e-32173450287+
COG5434PGU13.0e-5674394345+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN76963.104246933460hypothetical protein [Vitis vinifera]
EMBLCBI37530.1014741476unnamed protein product [Vitis vinifera]
RefSeqXP_002274138.1014741476PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310517.10454775437predicted protein [Populus trichocarpa]
RefSeqXP_002526639.104747747480polygalacturonase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3jur_D4.00001e-416844323417A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_C4.00001e-416844323417A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_B4.00001e-416844323417A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_A4.00001e-416844323417A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB1bhe_A3e-2111643649361A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2103EC-3.2.1.15polygalacturonase
Transmembrane Domains
StartEnd
2140
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7986623001694680
FF4011862471664120
EY1976652911334230
EX1659472911334230
CO1170952771984740
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00296.1Aquca_003_00639.3Aquca_003_00639.2Aquca_003_00639.1Aquca_003_00639.4
Aquca_014_00381.1Aquca_038_00086.1Aquca_037_00120.3Aquca_037_00120.2Aquca_037_00120.1
Aquca_038_00085.1Aquca_076_00048.1Aquca_020_00507.1
Arabidopsis lyrata486722906271492486866235486630
494984492520328395318449900877
477994493797472140905397906150
Arabidopsis thalianaAT3G62110.1AT4G23820.1AT3G48950.1AT3G61490.3AT3G61490.2
AT3G61490.1AT5G41870.1AT4G33440.1AT4G23500.1AT3G16850.1
AT5G49215.2AT5G49215.1AT2G23900.1AT3G06770.3AT3G06770.1
AT3G06770.2AT1G19170.1AT3G42950.1
Brachypodium distachyonBradi1g53430.2Bradi1g53430.1Bradi4g05050.1Bradi1g02720.2Bradi1g02720.1
Bradi2g43750.1Bradi1g52050.1Bradi4g11087.1Bradi1g76890.1Bradi3g13260.1
Bradi4g31250.1Bradi1g53430.3Bradi3g56787.1Bradi3g09590.1
Brassica rapaBra003485Bra007662Bra019264Bra013734Bra018023
Bra020656Bra007609Bra011440Bra019299Bra028511
Bra037005Bra013697Bra022182Bra037429Bra032138
Bra001642Bra001215Bra018004Bra016521Bra039462
Bra007626
Carica papayaevm.model.supercontig_107.107evm.model.supercontig_9.114evm.model.supercontig_29.51evm.model.supercontig_180.28evm.model.supercontig_57.18
evm.TU.contig_27928.2evm.model.supercontig_486.2evm.model.supercontig_151.35evm.model.supercontig_107.108evm.model.supercontig_28.9
Capsella rubellaCarubv10017170mCarubv10018803mCarubv10004811mCarubv10017147mCarubv10013686m
Carubv10026227mCarubv10004724mCarubv10004660mCarubv10024654mCarubv10004799m
Carubv10013668mCarubv10013478mCarubv10011469mCarubv10017105m
Citrus clementinaCiclev10020035mCiclev10004943mCiclev10004942mCiclev10019941mCiclev10019597m
Ciclev10004864mCiclev10003286mCiclev10020162mCiclev10008093m
Citrus sinensisorange1.1g012308morange1.1g012788morange1.1g011659morange1.1g009075morange1.1g011615m
orange1.1g013402morange1.1g020062morange1.1g020257morange1.1g023585morange1.1g021449m
orange1.1g038330morange1.1g036161morange1.1g038535morange1.1g036907m
Cucumis sativusCucsa.258550.1Cucsa.252790.1Cucsa.228510.1Cucsa.303830.1Cucsa.192980.1
Cucsa.141920.1
Eucalyptus grandisEucgr.K00562.2Eucgr.K00562.1Eucgr.D01821.1Eucgr.E00104.1Eucgr.E00105.1
Eucgr.D01730.1Eucgr.I00199.1Eucgr.A01315.1Eucgr.A02742.1Eucgr.E00853.1
Eucgr.A02740.1Eucgr.C00786.1
Fragaria vescamrna24477.1-v1.0-hybridmrna20022.1-v1.0-hybridmrna31826.1-v1.0-hybridmrna16186.1-v1.0-hybridmrna19241.1-v1.0-hybrid
mrna11093.1-v1.0-hybridmrna07072.1-v1.0-hybridmrna06153.1-v1.0-hybridmrna32082.1-v1.0-hybridmrna23300.1-v1.0-hybrid
mrna12538.1-v1.0-hybrid
Glycine maxGlyma19g40940.1Glyma10g27840.3Glyma10g27840.2Glyma03g38350.3Glyma03g38350.2
Glyma03g38350.1Glyma07g07280.1Glyma07g07290.2Glyma07g07290.1Glyma05g37490.1
Glyma02g01050.1Glyma08g02050.2Glyma08g02050.1Glyma07g37320.1Glyma07g37320.2
Glyma09g39200.1Glyma18g47130.1Glyma16g03680.2Glyma16g03680.1Glyma17g03300.1
Glyma15g15690.1Glyma09g04560.1Glyma08g41530.1Glyma18g14640.1Glyma10g37540.1
Glyma10g37530.1Glyma10g37540.2Glyma10g37540.3Glyma02g01910.1Glyma10g02030.1
Glyma14g03710.1Glyma03g37480.2Glyma03g37480.1Glyma19g40100.2Glyma16g29780.1
Glyma09g24470.1Glyma17g05550.1Glyma13g17170.1Glyma09g08270.1Glyma15g19820.1
Glyma14g03710.2Glyma10g02030.2Glyma02g45080.1Glyma20g30240.2Glyma19g40100.3.92.249
Glyma19g40100.3.92.249Glyma19g40100.3.251.383Glyma19g40100.3.251.383
Gossypium raimondiiGorai.008G134500.2Gorai.008G134500.1Gorai.004G147300.5Gorai.004G147300.4Gorai.004G147300.3
Gorai.004G147300.2Gorai.004G147300.1Gorai.006G077400.1Gorai.007G102200.2Gorai.007G102200.1
Gorai.001G158900.1Gorai.006G260100.3Gorai.006G260100.2Gorai.006G260100.1Gorai.011G194200.1
Gorai.012G035300.1Gorai.003G066600.1Gorai.003G155800.2Gorai.003G155800.1Gorai.008G274700.1
Gorai.004G138900.1Gorai.007G012900.1Gorai.007G026000.2Gorai.007G026000.1Gorai.004G134000.1
Gorai.012G035300.2Gorai.001G016500.1Gorai.009G036700.1Gorai.010G090400.1Gorai.007G026000.4
Gorai.004G134000.2Gorai.007G102200.4Gorai.007G102200.3Gorai.006G077400.2Gorai.006G077400.3
Gorai.009G036700.2Gorai.007G026000.3Gorai.004G134000.3Gorai.010G090400.2
Linum usitatissimumLus10038030Lus10007922Lus10032374Lus10028766Lus10017517
Lus10003589Lus10003890Lus10037714Lus10016837Lus10014799
Lus10023101Lus10039279Lus10027516Lus10027646Lus10039909
Lus10009972Lus10001899
Malus domesticaMDP0000130769MDP0000175027MDP0000137792MDP0000581832MDP0000610678
MDP0000202282MDP0000174216MDP0000147794MDP0000251956MDP0000254231
MDP0000225538MDP0000249285MDP0000249275MDP0000236768MDP0000321745
MDP0000766241MDP0000515489MDP0000128139MDP0000818931MDP0000665344
MDP0000269019MDP0000191981MDP0000292963MDP0000199345
Manihot esculentacassava4.1_026138mcassava4.1_007057mcassava4.1_007003mcassava4.1_023296mcassava4.1_007008m
cassava4.1_006215mcassava4.1_007421mcassava4.1_032219mcassava4.1_007592mcassava4.1_007544m
cassava4.1_033273mcassava4.1_026691mcassava4.1_026082mcassava4.1_008164mcassava4.1_006317m
cassava4.1_006279m
Medicago truncatulaMedtr7g110710.1Medtr4g120730.1Medtr7g088550.1Medtr7g038050.1Medtr7g078680.1
Medtr1g100050.1Medtr1g100060.1Medtr1g099850.1Medtr1g100040.1Medtr5g090160.1
Medtr3g096330.1Medtr1g086030.1Medtr2g042740.1Medtr4g124980.1Medtr2g083670.1
Mimulus guttatusmgv1a006147mmgv1a005694mmgv1a024920mmgv1a005601mmgv1a006062m
mgv1a023393mmgv1a006305mmgv1a005053mmgv1a004737mmgv1a005168m
Oryza sativaLOC_Os07g14160.1LOC_Os07g14160.4LOC_Os07g14160.3LOC_Os07g14160.2LOC_Os11g43750.1
LOC_Os03g61800.3LOC_Os03g61800.2LOC_Os03g61800.1LOC_Os05g50960.1LOC_Os12g36810.1
LOC_Os08g01600.1LOC_Os02g15690.1LOC_Os03g03350.1LOC_Os01g43160.1LOC_Os09g26800.1
LOC_Os02g54030.1
Panicum virgatumPavirv00030219mPavirv00058435mPavirv00018035mPavirv00034723mPavirv00048083m
Pavirv00017919mPavirv00069831mPavirv00004220mPavirv00021016mPavirv00014813m
Pavirv00063415mPavirv00050881mPavirv00038988mPavirv00052892mPavirv00056428m
Pavirv00042769mPavirv00017327mPavirv00038561mPavirv00048354mPavirv00014455m
Pavirv00035750mPavirv00054923m
Physcomitrella patensPp1s294_11V6.1Pp1s18_221V6.1Pp1s194_34V6.1Pp1s252_60V6.1Pp1s20_252V6.2
Pp1s60_185V6.1Pp1s20_252V6.1
Phaseolus vulgarisPhvul.001G218400.1Phvul.007G209200.1Phvul.002G292300.1Phvul.008G059700.1Phvul.007G165300.1
Phvul.009G252200.1Phvul.006G028800.1Phvul.008G199400.1Phvul.003G108700.1Phvul.004G047800.1
Phvul.007G217500.1Phvul.004G047700.1Phvul.004G108800.1Phvul.001G210300.2Phvul.001G210300.1
Phvul.009G151200.1Phvul.007G074300.1Phvul.003G129300.1Phvul.009G225400.1
Picea abiesMA_88519g0010MA_104339g0010MA_10430135g0020MA_10435166g0010MA_98717g0010
MA_6380g0020MA_11025g0010MA_345765g0010MA_9467735g0010MA_5735762g0010
MA_10436451g0020
Populus trichocarpaPotri.002G186900.2Potri.002G186900.1Potri.014G112100.1Potri.001G100000.1Potri.003G131700.1
Potri.010G005500.1Potri.010G008600.1Potri.008G211500.1Potri.002G162400.1Potri.007G105800.1
Potri.005G063400.1Potri.017G145900.1Potri.003G139100.1Potri.004G073900.1Potri.018G062700.2
Potri.006G139500.1Potri.018G062700.1Potri.006G139500.2Potri.002G162400.5Potri.002G162400.3
Potri.002G162400.2Potri.002G162400.4
Prunus persicappa005310mppa005599mppa005818mppa004996mppa005015m
ppa018224mppa006130mppa005185mppa020086mppa018901m
ppa004793m
Ricinus communis56826.m00002730190.m01126429726.m00410530169.m00662330174.m008646
30137.m00044030190.m01082329739.m00372830169.m006622.88.25030169.m006622.88.250
30169.m006622.270.40630169.m006622.270.40633029.m00002237576.m00002039176.m000013
Setaria italicaSi032032mSi035484mSi026354mSi006319mSi006318m
Si001461mSi035616mSi013629mSi022052mSi017201m
Si029141mSi016984m
Selaginella moellendorffii12401133152785567493499190
Sorghum bicolorSb02g007470.1Sb01g002550.1Sb10g000660.1Sb07g000740.1Sb03g028140.1
Sb04g009310.1Sb01g048880.1Sb09g030140.1Sb05g025980.1Sb02g025730.1
Sb04g035020.1
Thellungiella halophilaThhalv10005947mThhalv10005946mThhalv10005945mThhalv10005958mThhalv10025189m
Thhalv10005939mThhalv10025100mThhalv10025011mThhalv10004215mThhalv10020710m
Thhalv10020733mThhalv10000145mThhalv10027766mThhalv10027765mThhalv10010343m
Thhalv10007407mThhalv10002498mThhalv10011050m.73.238Thhalv10011050m.73.238Thhalv10011050m.276.426
Thhalv10011050m.276.426
Vitis viniferaGSVIVT01028246001GSVIVT01035089001GSVIVT01028057001GSVIVT01019516001GSVIVT01026477001
GSVIVT01015044001GSVIVT01019405001GSVIVT01028861001GSVIVT01026985001GSVIVT01028860001.80.271
GSVIVT01028860001.80.271GSVIVT01028860001.331.546GSVIVT01028860001.331.546
Zea maysAC231180.2_FGT006
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)