y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g22820.1
FamilyGT1
Protein PropertiesLength: 466 Molecular Weight: 51944.6 Isoelectric Point: 5.9452
ChromosomeChromosome/Scaffold: 06 Start: 19708865 End: 19710648
DescriptionUDP-glucosyl transferase 89B1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12134411e-36
  FLGNIASWGLVLNSFAELEKPYFEFLRKELGHDRVWAVGPLLPEDAKEERGGSSSVSVNDVVSWLDEKEDLKVVYVCFGSMAILSKDQTEAIQTALAKSG
  VHFIWSTKEAVNGNQETDRNERGLVIRGWAPQVVILRHRAVGAFLTHCGWNSVMESVVAGVPMLAWPMTADQYTDATLLVDELKVAKKVCEGENTVPDSD
  VLSRVLAESVSGNGAEVRRALQLKTAALD
Full Sequence
Protein Sequence     Length: 466     Download
MKTVLCCNDA ARPHVLVIPF PAQGHMIPLL DLTHNLITSN PTLTITILTT PKNKPLVSTL    60
LSSHPSIQTL ILPFPSHPSL PPGIENAKDM PLSIRPIMLS LSNLHQPLTN WFRSHPSPPR    120
FIISDMFCGW TQPLASELGI QRLVFSPSGA FAYSTMCFLW KETPKRENEQ DQNEVVSFHR    180
LPDSPEYPWW QVSPLFRSYL EGDLDSEKLR DWFLGNIASW GLVLNSFAEL EKPYFEFLRK    240
ELGHDRVWAV GPLLPEDAKE ERGGSSSVSV NDVVSWLDEK EDLKVVYVCF GSMAILSKDQ    300
TEAIQTALAK SGVHFIWSTK EAVNGNQETD RNERGLVIRG WAPQVVILRH RAVGAFLTHC    360
GWNSVMESVV AGVPMLAWPM TADQYTDATL LVDELKVAKK VCEGENTVPD SDVLSRVLAE    420
SVSGNGAEVR RALQLKTAAL DAVREGGSSD RDLRCLMERL RFPLQ*                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02555PLN025553.0e-41209461273+
PLN03004PLN030043.0e-452449465+
PLN02534PLN025345.0e-5810458482+
PLN03007PLN030076.0e-6512460486+
PLN02863PLN0286308460467+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG52529.1084648470AC016662_23 putative glucosyltransferase; 88035-86003 [Arabidopsis thaliana]
RefSeqNP_177529.2084608466UGT89B1 (UDP-GLUCOSYL TRANSFERASE 89B1); UDP-glycosyltransferase/ quercetin 3-O-glucosyltransferase/ quercetin 4'-O-glucosyltransferase/ quercetin 7-O-glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002273331.1084655479PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318584.10104602462predicted protein [Populus trichocarpa]
RefSeqXP_002514595.10114608464UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A9.99995e-4194533460B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2vch_A9.99995e-4194533460B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2vce_A9.99995e-4194533460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acv_B7e-381444911450A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A7e-381444911450A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Metabolic Pathways
Pathway NameReactionECProtein Name
curcumin glucoside biosynthesisRXN-7062EC-2.4.1UDP-glucose:curcumin glucosyltransferase
curcumin glucoside biosynthesisRXN-7063EC-2.4.1UDP-glucose:curcumin monoglucoside glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG631256480124600
FG6459072931284040
CK269710295123000
CV2265482761864450
EL343539254142640
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00233.1Aquca_006_00378.1Aquca_006_00376.1
Arabidopsis lyrata892083487125895254887793
Arabidopsis thalianaAT5G03490.1AT1G51210.1AT1G73880.1AT1G06000.1
Brachypodium distachyonBradi5g10710.1Bradi3g38930.1Bradi5g24280.1Bradi3g38937.1Bradi1g43600.1
Brassica rapaBra021887Bra014275Bra018901Bra003824
Carica papayaevm.model.supercontig_84.77evm.model.supercontig_3.220evm.model.supercontig_3.217
Capsella rubellaCarubv10012161mCarubv10023200mCarubv10019517m
Citrus clementinaCiclev10031430mCiclev10020006m
Citrus sinensisorange1.1g042753m
Cucumis sativusCucsa.149660.1
Eucalyptus grandisEucgr.B00651.1Eucgr.B00649.1Eucgr.B00652.1Eucgr.B00650.1Eucgr.B00655.1
Fragaria vescamrna04524.1-v1.0-hybridmrna04525.1-v1.0-hybridmrna26144.1-v1.0-hybrid
Glycine maxGlyma06g40390.1Glyma01g09160.1
Gossypium raimondiiGorai.012G185000.3Gorai.012G185000.2Gorai.012G185000.1Gorai.012G184900.1Gorai.008G174800.1
Gorai.012G185100.1Gorai.003G103500.1Gorai.006G228500.1Gorai.006G228600.1Gorai.006G228800.1
Linum usitatissimumLus10034650Lus10013500Lus10036840Lus10036837Lus10007972
Malus domesticaMDP0000452163MDP0000322436MDP0000221563MDP0000234849
Manihot esculentacassava4.1_034323mcassava4.1_006835mcassava4.1_006752mcassava4.1_028099m
Medicago truncatulaMedtr2g059240.1
Mimulus guttatusmgv1a019609mmgv1a008307m
Oryza sativaLOC_Os06g17260.1LOC_Os08g38160.1LOC_Os04g55680.1LOC_Os08g38130.1LOC_Os08g38110.1
LOC_Os06g17120.1LOC_Os06g17140.1LOC_Os06g17250.1LOC_Os06g17020.1LOC_Os06g17110.1
Panicum virgatumPavirv00056484mPavirv00050341mPavirv00051468mPavirv00041386mPavirv00036251m
Pavirv00055583mPavirv00021505mPavirv00001223mPavirv00015738mPavirv00056972m
Phaseolus vulgarisPhvul.003G036900.1Phvul.011G151100.1Phvul.011G151200.1
Picea abiesMA_11273g0020MA_10434954g0010MA_9790207g0010MA_265454g0010MA_57964g0010
MA_705145g0010
Populus trichocarpaPotri.010G137000.1Potri.012G065100.1
Prunus persicappa024271mppa018626m
Ricinus communis30138.m00391130138.m00390930138.m00389030138.m003910
Setaria italicaSi019365mSi015554mSi009974mSi013651mSi015553m
Sorghum bicolorSb07g028920.1Sb06g030880.1Sb10g010340.1Sb06g030820.1Sb10g010343.1
Thellungiella halophilaThhalv10012395mThhalv10018506m
Vitis viniferaGSVIVT01008168001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)