y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g28630.1
FamilyGH9
Protein PropertiesLength: 154 Molecular Weight: 17235.9 Isoelectric Point: 9.4247
ChromosomeChromosome/Scaffold: 06 Start: 27167556 End: 27168151
Descriptionglycosyl hydrolase 9B7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9471541.5e-26
  MFRNAFILFPLKYAGRLVDNKISWRGNSALKDGSQAKLDLSKGMYDVGDNMKFGFSMAFTATVQSWSILEYGDQMDHVGQLDAAQYSLKWITDFLINAHP
  SENVLYIQ
Full Sequence
Protein Sequence     Length: 154     Download
PSLPLFLPLR RNLVTAVPIS LLQFPVPLAP LTKNTALHSK PQCNSSMFRN AFILFPLKYA    60
GRLVDNKISW RGNSALKDGS QAKLDLSKGM YDVGDNMKFG FSMAFTATVQ SWSILEYGDQ    120
MDHVGQLDAA QYSLKWITDF LINAHPSENV LYIQ                                180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02613PLN026134.0e-2851154105+
PLN02171PLN021712.0e-315515299+
PLN00119PLN001196.0e-3250154106+
pfam00759Glyco_hydro_94.0e-3347154109+
PLN02345PLN023452.0e-5951154104+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF79918.13.99931e-425115456159AC022472_27 Contains similarity to beta-1,4-glucanase 1 (EG1) from Mastotermes darwiniensis gb
DDBJBAF42037.14.2039e-454215455167cellulase2 [Pyrus communis]
RefSeqXP_002276739.104515456165PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002307711.15.04467e-445115462165predicted protein [Populus trichocarpa]
RefSeqXP_002510516.14.06377e-445115462165endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4tf4_B5e-25451547117A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB4tf4_A5e-25451547117A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB3tf4_B5e-25451547117A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB3tf4_A5e-25451547117A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB1tf4_B5e-25451547117A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO036869113421540
GR85330015411540
DB958357113421540
DB958357923941e-20
HO036869593610.000000000003
Orthologous Group
SpeciesID
Glycine maxGlyma03g08040.1
Malus domesticaMDP0000178787
Panicum virgatumPavirv00020322m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny