y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g35110.1
FamilyGT1
Protein PropertiesLength: 463 Molecular Weight: 51449.3 Isoelectric Point: 6.4621
ChromosomeChromosome/Scaffold: 06 Start: 36946835 End: 36948223
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12264252e-23
  GNFCDYIASQFGKKVLLTGPVLPEEAEGKLEENWANWLDAFANESIVYCAFGSQINLEKDQFQELLLGFELSGLPFLVALKTPRGCESVEEALPEGFEER
  VKGRGVVSRGWVQQLLILKHPSVGCFVNHCGFGSMWESLMSDKQIVLVPQLGDQVLNTKLLVEELGVAVEVERGGNGWVSKESLSKAIKLVMDGDSEVGA
Full Sequence
Protein Sequence     Length: 463     Download
MAPTRNHLLH IAMFPWFATG HMTPFLHLSN ELAKRGHKIT FLLPKKAKLQ LQHLNNHPHL    60
ITFHTLTIPH VKGLPHGTET ASEIPISLNH LLVIAMDKTR DQVEHTLSAT NPDFVLYDNA    120
YWVPQIAKKL GIKTICYNVV CAASLAIVLV PARNVPKDRP ITVEELSQPP EGYPSSKVVL    180
TGLEAESLMF ISVPFGEDNI TFYDRITSAL RESDAIAIRT SREIEGNFCD YIASQFGKKV    240
LLTGPVLPEE AEGKLEENWA NWLDAFANES IVYCAFGSQI NLEKDQFQEL LLGFELSGLP    300
FLVALKTPRG CESVEEALPE GFEERVKGRG VVSRGWVQQL LILKHPSVGC FVNHCGFGSM    360
WESLMSDKQI VLVPQLGDQV LNTKLLVEEL GVAVEVERGG NGWVSKESLS KAIKLVMDGD    420
SEVGARVKKN HMEWKKTGGS PNLMNGYMDR FVQNLQDFPL HG*                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028633.0e-4610460476+
PLN02670PLN026709.0e-705457469+
PLN00414PLN004142.0e-1639457452+
PLN02208PLN022081.0e-1749458451+
PLN02764PLN027648.0e-1809458453+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN63557.1014561441hypothetical protein [Vitis vinifera]
RefSeqNP_194487.1094586446glycosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002282825.1014563457PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316802.1044616462predicted protein [Populus trichocarpa]
RefSeqXP_002523261.1014581457UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A2e-25207433201443A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB2vch_A2e-25207433201443A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase
PDB2vce_A2e-25207433201443A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB3hbj_A8e-24191446198439A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB3hbf_A8e-24191446198439A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
Metabolic Pathways
Pathway NameReactionECProtein Name
anthocyanidin sophoroside metabolismRXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8177EC-2.4.1pelargonidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8178EC-2.4.1delphinidin 3-O-glucoside 2''-O-glucosyltransferase
superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside)RXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY287600380113840
DY268485351113580
DY281585309113190
DY286488357113640
FC901086300113100
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna29784.1-v1.0-hybridmrna13733.1-v1.0-hybrid
mrna16457.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma12g34045.1Glyma06g43880.1Glyma12g14050.1
Glyma13g36500.1Glyma13g36490.1Glyma12g34030.1Glyma08g44550.1Glyma13g32770.1
Gossypium raimondiiGorai.007G157200.1Gorai.002G066600.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1
Gorai.010G242800.1Gorai.002G065500.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2Phvul.005G093500.1
Populus trichocarpaPotri.011G061000.1Potri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014265001GSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001
GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)