y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g38076.1
FamilyAA7
Protein PropertiesLength: 207 Molecular Weight: 22347.4 Isoelectric Point: 4.7884
ChromosomeChromosome/Scaffold: 06 Start: 40854187 End: 40854915
DescriptionFAD-binding Berberine family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7662050
  LRIRSGGHDYEGLSYVSEVETPFIIVDLSKLHAVNVDIEDNTAWIQVGATIGEVYYKIYEKSLVHGFPAGLCTSLGVGGHITGGAYGSMMRKYGLGVDNV
  LDARIVDANGQILDREAVGEDLFWAIRKGGGASFGILLWW
Full Sequence
Protein Sequence     Length: 207     Download
MVSPSSNLAT LILLLSVSMA ASASFEENFV QCLSFYSDKA APFYASIYTP QNASFNKILE    60
SSTQNLRIRS GGHDYEGLSY VSEVETPFII VDLSKLHAVN VDIEDNTAWI QVGATIGEVY    120
YKIYEKSLVH GFPAGLCTSL GVGGHITGGA YGSMMRKYGL GVDNVLDARI VDANGQILDR    180
EAVGEDLFWA IRKGGGASFG ILLWWK*                                        240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00387glcD6.0e-510117878+
COG0277GlcD5.0e-1666205149+
pfam01565FAD_binding_42.0e-2166179115+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN81654.101120612243hypothetical protein [Vitis vinifera]
RefSeqXP_002268361.101120612243PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002299035.101120614245predicted protein [Populus trichocarpa]
RefSeqXP_002523162.102720631246Reticuline oxidase precursor, putative [Ricinus communis]
RefSeqXP_002523164.101920623246Reticuline oxidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4dns_B01420626221A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB4dns_A01420626221A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3vte_A0620617218A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
PDB3tsj_B1.99993e-416520678219A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
PDB3tsj_A1.99993e-416520678219A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
Metabolic Pathways
Pathway NameReactionECProtein Name
cannabinoid biosynthesisRXN-7854EC-1.21.3tetrahydrocannabinolic acid synthase
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV27198522911930
FG89011622311870
EV26199122631920
FS32353922611900
GO020148215262040
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00740.1Aquca_001_00480.1Aquca_026_00213.1Aquca_001_00289.1Aquca_001_00278.1
Aquca_070_00001.1Aquca_006_00398.1Aquca_020_00180.1Aquca_030_00404.1Aquca_009_00318.1
Aquca_006_00397.1Aquca_009_00359.1Aquca_066_00049.1Aquca_008_00189.1Aquca_037_00334.1
Aquca_001_00276.1Aquca_001_00285.1Aquca_009_00360.1
Arabidopsis lyrata917168494545494550890626917162
472778472781914600471318492802
492806472780472779890629470076
890627473304492803902567917159.140.470
917159.140.470890625330958354696494546
473604902566473307
Arabidopsis thalianaAT5G44440.1AT5G44380.1AT5G44360.1AT1G30710.1AT1G34575.1
AT4G20820.1AT4G20840.1AT1G30730.1AT1G26390.1AT1G11770.1
AT1G26410.1AT4G20800.1AT1G30720.1AT1G30740.1AT1G01980.1
AT4G20830.2AT4G20830.1AT2G34810.1AT1G26420.1AT1G26400.1
AT1G26380.1AT1G30700.1AT4G20860.1AT1G30760.1AT2G34790.1
AT5G44390.1AT5G44400.1AT5G44410.1
Brachypodium distachyonBradi3g16460.1Bradi1g38250.1Bradi1g38270.1Bradi3g09380.1Bradi5g17300.1
Bradi4g18970.1Bradi1g38260.1Bradi5g02967.1Bradi5g02900.1
Brassica rapaBra027555Bra033740Bra013501Bra013478Bra033743
Bra014885Bra024719Bra024717Bra014886Bra013476
Bra023126Bra013473Bra019831Bra013475Bra013472
Bra028530Bra031780Bra038798Bra038799Bra020915
Bra005390Bra023127Bra016272Bra023123.188.506Bra023123.188.506
Bra033739Bra023122Bra022992Bra027547Bra021930
Bra006964Bra005392Bra014890Bra023131Bra027553
Bra027549
Carica papayaevm.model.supercontig_21.234evm.model.supercontig_677.3evm.model.supercontig_166.52evm.model.supercontig_2512.1evm.TU.contig_36442.2
evm.model.supercontig_677.6evm.TU.contig_36542.2evm.model.supercontig_677.5evm.model.supercontig_677.4evm.TU.contig_36130.1
evm.TU.contig_34892.1evm.TU.contig_36661.1evm.TU.contig_43917.1evm.model.supercontig_677.7evm.model.supercontig_166.49
evm.model.supercontig_166.51
Capsella rubellaCarubv10007418mCarubv10007797mCarubv10026133mCarubv10007331mCarubv10027532m
Carubv10008827mCarubv10026203mCarubv10004576mCarubv10008759mCarubv10012287m
Carubv10011326mCarubv10011178mCarubv10008831mCarubv10011480mCarubv10011431m
Carubv10008807mCarubv10006337mCarubv10011221mCarubv10004466mCarubv10008739m
Carubv10008832mCarubv10006505mCarubv10008825mCarubv10022944mCarubv10022971m
Carubv10026190mCarubv10008835mCarubv10026198mCarubv10026204m
Citrus clementinaCiclev10014802mCiclev10014810mCiclev10004697mCiclev10018216mCiclev10003189m
Ciclev10027115mCiclev10014815mCiclev10017860mCiclev10027503mCiclev10017832m
Ciclev10017768mCiclev10014826mCiclev10014748mCiclev10027526mCiclev10000814m
Ciclev10004673mCiclev10006465mCiclev10003156mCiclev10000808mCiclev10000802m
Ciclev10006451mCiclev10014838mCiclev10018073mCiclev10014829mCiclev10017845m
Ciclev10018357mCiclev10014857mCiclev10007008mCiclev10014803mCiclev10014726m
Ciclev10017782mCiclev10007159mCiclev10018353mCiclev10018146mCiclev10006703m
Ciclev10006906mCiclev10000813mCiclev10000811mCiclev10003556mCiclev10000810m
Ciclev10000817mCiclev10004013m
Citrus sinensisorange1.1g008842morange1.1g048392morange1.1g036220morange1.1g009297morange1.1g009727m
orange1.1g039163morange1.1g042207morange1.1g046660morange1.1g035812morange1.1g043104m
orange1.1g040700morange1.1g040771morange1.1g015646morange1.1g042223morange1.1g009485m
orange1.1g009399morange1.1g037058morange1.1g009115morange1.1g038259morange1.1g043814m
orange1.1g008779morange1.1g046361morange1.1g009286morange1.1g009342morange1.1g042619m
Cucumis sativusCucsa.048460.1Cucsa.166870.1Cucsa.166810.1Cucsa.048450.1Cucsa.167230.1
Cucsa.167240.1Cucsa.048470.1Cucsa.166840.1Cucsa.167320.1Cucsa.167330.1
Cucsa.048480.1Cucsa.167250.1Cucsa.167300.1Cucsa.167270.1Cucsa.048430.1
Cucsa.166850.1Cucsa.048490.1Cucsa.166860.1Cucsa.166830.1Cucsa.167310.1
Cucsa.167260.1Cucsa.167280.1Cucsa.207580.1
Eucalyptus grandisEucgr.D01625.1Eucgr.D00089.1Eucgr.D00078.1Eucgr.D00086.1Eucgr.D01005.1
Eucgr.D00082.1Eucgr.D01626.1Eucgr.D00076.1Eucgr.D01004.1Eucgr.D00075.1
Eucgr.D01011.1Eucgr.D01623.1Eucgr.L02929.1Eucgr.D00071.1Eucgr.D00073.1
Eucgr.D00077.1Eucgr.D01006.1Eucgr.D01617.1Eucgr.D00074.1Eucgr.D01003.1
Eucgr.D01053.1Eucgr.D00084.1Eucgr.L02344.1Eucgr.D01622.1Eucgr.D00088.1
Eucgr.D01008.1Eucgr.D01614.1Eucgr.D00085.1Eucgr.D01619.1Eucgr.D00070.1
Fragaria vescamrna31189.1-v1.0-hybridmrna20179.1-v1.0-hybridmrna20170.1-v1.0-hybridmrna20167.1-v1.0-hybridmrna20156.1-v1.0-hybrid
mrna20131.1-v1.0-hybridmrna20163.1-v1.0-hybridmrna20166.1-v1.0-hybridmrna20176.1-v1.0-hybridmrna20169.1-v1.0-hybrid
mrna20171.1-v1.0-hybridmrna20132.1-v1.0-hybridmrna20160.1-v1.0-hybridmrna20178.1-v1.0-hybridmrna20173.1-v1.0-hybrid.74.286
mrna20173.1-v1.0-hybrid.74.286mrna20173.1-v1.0-hybrid.74.286mrna20173.1-v1.0-hybrid.562.753mrna20173.1-v1.0-hybrid.562.753mrna20173.1-v1.0-hybrid.562.753
mrna20161.1-v1.0-hybrid
Glycine maxGlyma20g35570.1Glyma10g32070.1Glyma06g47980.1Glyma08g11890.1Glyma05g25460.1
Glyma05g25130.1Glyma08g08500.1Glyma15g14200.1Glyma09g02630.1Glyma05g25470.1
Glyma08g08570.2Glyma09g03120.1Glyma15g14040.1Glyma08g08530.1Glyma15g14210.1
Glyma09g03100.1Glyma08g08520.1Glyma05g25590.1Glyma08g06350.1Glyma05g25540.1
Glyma08g06360.1Glyma09g03290.1Glyma15g14170.1Glyma09g03270.1Glyma15g14060.1
Glyma15g14030.1Glyma09g03130.1Glyma08g08460.1Glyma15g14020.1Glyma09g03090.1
Glyma08g08550.1Glyma05g25580.1Glyma04g12600.1Glyma06g48000.1Glyma09g03283.1
Glyma08g08480.1Glyma07g30940.2Glyma08g08490.1Glyma05g25500.1Glyma05g25450.1
Glyma04g12580.1Glyma15g14080.1Glyma08g08540.1Glyma04g12610.1Glyma05g25485.1
Gossypium raimondiiGorai.001G069600.1Gorai.005G121900.1Gorai.011G129700.1Gorai.013G021500.1Gorai.006G197300.1
Gorai.011G007500.1Gorai.011G121800.1Gorai.006G197400.1Gorai.011G007000.1Gorai.007G011000.1
Gorai.011G007800.1Gorai.011G007400.1Gorai.005G023900.1Gorai.009G117200.1Gorai.011G007200.1
Gorai.010G221700.1Gorai.005G024700.1Gorai.011G007300.1Gorai.005G024100.1Gorai.005G024000.1
Gorai.005G024500.1Gorai.005G024600.1Gorai.010G221400.1Gorai.011G150800.1Gorai.008G278800.1
Gorai.005G023600.1Gorai.012G166900.1Gorai.005G023500.1Gorai.011G007700.1Gorai.008G278900.1
Gorai.012G167000.1Gorai.005G024300.1Gorai.004G168300.1Gorai.005G121800.1Gorai.010G221500.1
Gorai.010G142800.1Gorai.011G007100.1Gorai.008G278700.1Gorai.005G023800.1
Linum usitatissimumLus10010643Lus10023363Lus10023361Lus10023375Lus10038446
Lus10023365Lus10012641Lus10038436Lus10035466Lus10026775
Lus10001965Lus10008410Lus10033516Lus10021289Lus10023366
Lus10038440Lus10023374Lus10038439Lus10038437Lus10018119
Lus10036147Lus10032943Lus10009009Lus10041290Lus10039682
Lus10026290Lus10038445Lus10023376Lus10038442Lus10020858
Malus domesticaMDP0000316265MDP0000157943
Manihot esculentacassava4.1_022715mcassava4.1_032086mcassava4.1_005673mcassava4.1_023171mcassava4.1_025434m
cassava4.1_024802mcassava4.1_005789mcassava4.1_023945mcassava4.1_027438mcassava4.1_021732m
cassava4.1_022638mcassava4.1_029730mcassava4.1_027037mcassava4.1_033641mcassava4.1_004967m
cassava4.1_034231mcassava4.1_004979m
Medicago truncatulaMedtr7g034740.1Medtr3g009880.1Medtr3g009820.1Medtr4g091170.1Medtr4g091150.1
Medtr2g031510.1Medtr2g031490.1Medtr4g091200.1AC233657_27.1Medtr4g091190.1
Medtr3g009760.1Medtr2g031420.1Medtr2g031390.1Medtr2g031460.1
Mimulus guttatusmgv1a020959mmgv1a004329mmgv1a026362mmgv1a004045mmgv1a027155m
mgv1a003949mmgv1a018986mmgv1a021270mmgv1a021309mmgv1a022353m
mgv1a004108mmgv1a004305mmgv1a004698mmgv1a023470mmgv1a004278m
mgv1a004131mmgv1a024002mmgv1a019888mmgv1a026678mmgv1a020088m
mgv1a024529mmgv1a020594mmgv1a004053mmgv1a017902mmgv1a026045m
mgv1a003997m
Oryza sativaLOC_Os08g06190.1LOC_Os08g06170.1LOC_Os08g25490.1LOC_Os06g35590.1LOC_Os08g06180.1
LOC_Os06g35630.1LOC_Os06g35560.1LOC_Os11g30310.1LOC_Os06g35700.1LOC_Os06g35650.1
LOC_Os06g35660.1
Panicum virgatumPavirv00019442mPavirv00068789mPavirv00001496mPavirv00055040mPavirv00068431m
Pavirv00062394mPavirv00029223mPavirv00012042mPavirv00015387mPavirv00032493m
Pavirv00019776mPavirv00013972mPavirv00037665mPavirv00033493mPavirv00020643m
Pavirv00052121mPavirv00043706mPavirv00044998mPavirv00000028mPavirv00039506m
Pavirv00009817mPavirv00028562mPavirv00019648mPavirv00035481mPavirv00068013m
Pavirv00005996mPavirv00005341mPavirv00010885mPavirv00049757mPavirv00069462m
Pavirv00068961mPavirv00034737mPavirv00013174mPavirv00068750m
Phaseolus vulgarisPhvul.007G113300.1Phvul.002G234800.1Phvul.002G199800.1Phvul.005G004700.1Phvul.002G221900.1
Phvul.005G004400.1Phvul.002G221800.1Phvul.002G199500.1Phvul.005G004600.1Phvul.002G222000.1
Phvul.006G124600.1Phvul.002G198800.1Phvul.002G199300.1Phvul.006G125700.1Phvul.006G124800.1
Phvul.002G199200.1Phvul.002G199100.1Phvul.006G125600.1Phvul.006G125000.1Phvul.006G125500.1
Phvul.002G200300.1Phvul.006G124700.1Phvul.002G200600.1Phvul.002G199700.1Phvul.006G125800.1
Phvul.002G200800.1Phvul.002G200700.1Phvul.002G200200.1Phvul.002G200400.1Phvul.006G125400.1
Phvul.002G199000.1Phvul.002G199600.1Phvul.002G200000.1Phvul.002G200100.1
Picea abiesMA_26891g0010MA_162773g0010MA_186285g0010MA_132990g0010
Populus trichocarpaPotri.019G063400.1Potri.011G158400.1Potri.011G163000.1Potri.011G161800.1Potri.001G470100.1
Potri.011G158700.1Potri.001G461500.1Potri.001G440700.1Potri.001G462600.2Potri.001G462600.1
Potri.001G461900.1Potri.001G462100.1Potri.011G161500.1Potri.001G461800.1Potri.001G464800.1
Potri.001G462000.1Potri.011G158100.2Potri.011G158100.1Potri.011G159900.1Potri.001G461700.1
Potri.011G159600.1Potri.011G160900.1Potri.011G161100.1Potri.011G162700.1Potri.011G158300.1
Potri.001G459500.1Potri.T140200.1Potri.001G463300.1Potri.001G463400.1Potri.012G034700.1
Potri.011G157900.1Potri.015G025900.1Potri.011G160400.1Potri.011G160300.1Potri.011G160200.1
Potri.011G159300.1Potri.011G159200.1Potri.011G159100.1Potri.011G155900.1Potri.001G459200.1
Potri.011G156000.1Potri.011G161400.1Potri.006G128900.1Potri.001G463100.1Potri.011G160700.1
Potri.011G161600.1Potri.011G158500.1Potri.011G160500.1Potri.011G159400.1Potri.001G459100.1
Potri.T140100.1Potri.011G158000.1Potri.011G159500.1Potri.011G160100.1Potri.001G462800.1
Potri.011G160000.1Potri.001G462200.1Potri.011G162800.1Potri.001G464700.1Potri.011G158800.1
Potri.011G162900.1Potri.001G462400.1Potri.011G161300.1Potri.011G158600.1Potri.001G462700.1
Potri.001G463500.1
Prunus persicappa023762mppa005451mppa018650mppa004127mppa018446m
ppa023336mppa004021mppa019803mppa014683mppa016588m
ppa004317mppa019761mppa020251mppa026518mppa004087m
ppa017444mppa004076mppa022785mppa024922mppa006568m
ppa024148mppa022296mppa027050mppa022216mppa016294m
ppa004103mppa003798mppa004189mppa026775mppa025579m
ppa026226mppa018084mppa022422m
Ricinus communis28885.m00011130075.m00114930075.m00115630075.m00114530075.m001140
30075.m00114130075.m00114429776.m00047930075.m00113830075.m001143
29776.m00048030075.m00114730075.m00114630075.m00115330075.m001142
30075.m00115130075.m001137
Setaria italicaSi015778mSi013528mSi013532mSi006230mSi013559m
Si012681mSi008271mSi020217mSi016790mSi027882m
Si026223mSi007896mSi008819mSi015253m
Sorghum bicolorSb07g003930.1Sb10g021680.1Sb07g003940.1Sb10g021670.1Sb07g000490.1
Sb04g008542.1Sb05g017260.1Sb07g003960.1Sb07g003920.1Sb10g021700.1
Sb10g021690.1Sb10g021685.1Sb06g014450.1Sb05g017260.2
Thellungiella halophilaThhalv10000840mThhalv10000843mThhalv10000842mThhalv10000846mThhalv10003322m
Thhalv10000845mThhalv10027093mThhalv10007337mThhalv10000844mThhalv10007341m
Thhalv10007336mThhalv10027126mThhalv10007308mThhalv10007344mThhalv10027426m
Thhalv10017619mThhalv10009705mThhalv10007352mThhalv10024886mThhalv10007354m
Thhalv10007313mThhalv10024789mThhalv10016482mThhalv10027353mThhalv10026881m
Thhalv10016496mThhalv10000851mThhalv10000841mThhalv10007327mThhalv10001137m
Vitis viniferaGSVIVT01021726001GSVIVT01021629001GSVIVT01020746001GSVIVT01003283001GSVIVT01015790001
GSVIVT01015792001
Zea maysAC203909.3_FGT007AC203909.3_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)