y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g43701.1
FamilyAA1
Protein PropertiesLength: 397 Molecular Weight: 43729.8 Isoelectric Point: 9.0375
ChromosomeChromosome/Scaffold: 06 Start: 46724655 End: 46727498
DescriptionLaccase/Diphenol oxidase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1223820
  FNVVYNFTLTGQRGTLWWHAHILWLRATVHGALVILPKLGVPYPFPKPNREQVIILSEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPIQGWFKLD
  VQPGNTYLLRIINAALNEELFFKIAGHELTVVEVDAVYTKPFKTDTILIAPGQTTNVLLTTKHETGKYLTATATLHYLGTLGSTITTLTSMPPRNATPLA
  TTFTDSLRSLNSEKYPARVPLRIDHNLLFTVSLSVNPCATCVNNSRVVADINNVTFVMPKISLLQAHFLKIKGVFTDDFPGNPPVTMKGTRVYRLAYNST
  VQLVLQDTGMITPENHPIHLHGIFFLLLLKFNLGDPVEKNTVGVPAGGWTAIRFRADNPGP
Full Sequence
Protein Sequence     Length: 397     Download
MLLLAACLLP LSGEAMVRYY KFNVVYNFTL TGQRGTLWWH AHILWLRATV HGALVILPKL    60
GVPYPFPKPN REQVIILSEW WKSDTEAVIN EALKSGLAPN VSDAHTINGH PGPIQGWFKL    120
DVQPGNTYLL RIINAALNEE LFFKIAGHEL TVVEVDAVYT KPFKTDTILI APGQTTNVLL    180
TTKHETGKYL TATATLHYLG TLGSTITTLT SMPPRNATPL ATTFTDSLRS LNSEKYPARV    240
PLRIDHNLLF TVSLSVNPCA TCVNNSRVVA DINNVTFVMP KISLLQAHFL KIKGVFTDDF    300
PGNPPVTMKG TRVYRLAYNS TVQLVLQDTG MITPENHPIH LHGIFFLLLL KFNLGDPVEK    360
NTVGVPAGGW TAIRFRADNP GPNESLLPPP SDLPKC*                             420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02168PLN021683.0e-2223381396+
PLN02604PLN026049.0e-2535381407+
TIGR03388ascorbase1.0e-2925381430+
pfam00394Cu-oxidase4.0e-4171198145+
TIGR03389laccase025396451+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC49536.1023396108557diphenol oxidase [Nicotiana tabacum]
RefSeqXP_002314124.1025396111556predicted protein [Populus trichocarpa]
RefSeqXP_002520425.1025396111556laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B2e-252638191501A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1asq_A2e-252638191501A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1asp_B2e-252638191501A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1asp_A2e-252638191501A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1aso_B2e-252638191501A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Signal Peptide
Cleavage Site
15
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797675453253970
DY294712338253270
FC895749305253060
EL453925297253000
DY969193285252860
Orthologous Group
SpeciesID
Linum usitatissimumLus10040226
Medicago truncatulaMedtr5g081790.1
Phaseolus vulgarisPhvul.007G093200.1Phvul.009G027800.1Phvul.001G122100.1
Picea abiesMA_6005856g0010MA_7461249g0010MA_10435604g0010MA_1991g0010MA_9916300g0010
Vitis viniferaGSVIVT01033192001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny