y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g43880.1
FamilyGT1
Protein PropertiesLength: 460 Molecular Weight: 51109 Isoelectric Point: 5.592
ChromosomeChromosome/Scaffold: 06 Start: 46884286 End: 46886509
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12074363e-23
  NEADLLAYRTCREIEGPYMDYIGKQFNKPVVATGPVILDPPTLDLEEKFSTWLGGFEPGSVVYCCFGSECTLRPNQFLELVLGLELTGMPFLAAVKAPLG
  FETVESAMPEGFQERVKGRGFVYGGWVQQQLILAHPSVGCFITHCGSGSLSEALVNKCQLVLLPNVGDQILNARMMGTNLEVGVEVEKGDEDGMYTKESV
  CKAVSIVMDCENETSKRVRANHARIRELLL
Full Sequence
Protein Sequence     Length: 460     Download
MKSRPLHIAM YPWLAMGHQT AFLHLCNKLA IRGHKISFIT PPKAQAKLEP FNLHPNSITF    60
VTINVPHVEG LPPDAQTTAD VTYPLQPQIM TAMDLTKDDI ETLLTGLKPD LVFYDFTHWM    120
PALAKRLGIK AVHYCTASSV MVGYTLTPSR FHQGTDLMES DLMEPPEGYP DSSIKLQTHE    180
ARTFAAKRKD TFGSNVLFYD RQFIALNEAD LLAYRTCREI EGPYMDYIGK QFNKPVVATG    240
PVILDPPTLD LEEKFSTWLG GFEPGSVVYC CFGSECTLRP NQFLELVLGL ELTGMPFLAA    300
VKAPLGFETV ESAMPEGFQE RVKGRGFVYG GWVQQQLILA HPSVGCFITH CGSGSLSEAL    360
VNKCQLVLLP NVGDQILNAR MMGTNLEVGV EVEKGDEDGM YTKESVCKAV SIVMDCENET    420
SKRVRANHAR IRELLLNKDL ESSYVDSFCM RLQEIVEGI*                          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02534PLN025343.0e-412434474+
PLN02670PLN026703.0e-816454469+
PLN00414PLN004141.0e-1376453451+
PLN02764PLN027647.0e-1416458457+
PLN02208PLN022084.0e-1414454456+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABL74480.1074569458glucosyltransferase [Ipomoea batatas]
GenBankACU24192.1014571458unknown [Glycine max]
DDBJBAD95881.1074569458glucosyltransferase [Ipomoea nil]
DDBJBAD95882.1074569458glucosyltransferase [Ipomoea purpurea]
RefSeqXP_002522508.1014561456UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A5e-2524333444A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB2vch_A5e-2524333444A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB2vce_A5e-2524333444A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A4e-24234433238427A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c1z_A4e-24234433238427A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
anthocyanidin sophoroside metabolismRXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8177EC-2.4.1pelargonidin 3-O-glucoside 2''-O-glucosyltransferase
anthocyanidin sophoroside metabolismRXN-8178EC-2.4.1delphinidin 3-O-glucoside 2''-O-glucosyltransferase
superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside)RXN-8176EC-2.4.1cyanidin 3-O-glucoside 2''-O-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778286427324570
FE70114825412540
DY27255433613360
FE7011492062514560
HO778286279350.056
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00117.1Aquca_038_00188.1Aquca_055_00115.1Aquca_023_00112.1Aquca_011_00587.1
Aquca_011_00580.1
Arabidopsis lyrata474186918511492036495482918509
475492
Arabidopsis thalianaAT3G29630.1AT5G53990.1AT5G54010.1AT5G54060.1AT1G64910.1
Brassica rapaBra029046Bra022688Bra029045
Carica papayaevm.model.supercontig_8.121
Capsella rubellaCarubv10027945m
Citrus clementinaCiclev10017784mCiclev10008184mCiclev10015186m
Citrus sinensisorange1.1g039043morange1.1g017557morange1.1g012080m
Cucumis sativusCucsa.032470.1Cucsa.148900.1Cucsa.148870.1Cucsa.148880.1Cucsa.180970.1
Eucalyptus grandisEucgr.F03293.1Eucgr.F03295.1Eucgr.K01076.1Eucgr.K01079.1Eucgr.F03297.1
Fragaria vescamrna16456.1-v1.0-hybridmrna27158.1-v1.0-hybridmrna20937.1-v1.0-hybridmrna29784.1-v1.0-hybridmrna13733.1-v1.0-hybrid
mrna16457.1-v1.0-hybrid
Glycine maxGlyma10g33790.1Glyma20g33810.1Glyma12g34045.1Glyma12g14050.1Glyma13g36500.1
Glyma13g36490.1Glyma06g35110.1Glyma12g34030.1Glyma08g44550.1Glyma13g32770.1
Gossypium raimondiiGorai.007G157200.1Gorai.002G066600.1Gorai.002G065400.1Gorai.002G065400.2Gorai.002G065300.1
Gorai.010G242800.1Gorai.002G065500.1Gorai.010G230400.1Gorai.010G230200.1Gorai.009G439200.1
Linum usitatissimumLus10008453Lus10013337Lus10040178
Malus domesticaMDP0000311492MDP0000729320MDP0000319451MDP0000729321
Manihot esculentacassava4.1_028194mcassava4.1_024244mcassava4.1_026854mcassava4.1_021802mcassava4.1_007290m
Medicago truncatulaMedtr4g079270.1Medtr4g079250.1Medtr2g014900.1Medtr2g083390.1Medtr2g083420.1
Mimulus guttatusmgv1a019428mmgv1a006277mmgv1a006102mmgv1a006231mmgv1a021196m
Panicum virgatumPavirv00057507m
Phaseolus vulgarisPhvul.007G135800.1Phvul.011G136400.1Phvul.011G115700.1Phvul.005G093600.1Phvul.011G128700.1
Phvul.011G138500.1Phvul.011G138600.1Phvul.005G093300.1Phvul.005G093500.2Phvul.005G093500.1
Populus trichocarpaPotri.011G061000.1Potri.011G060300.1Potri.006G179700.1Potri.011G097900.1
Prunus persicappa022356mppa024453m
Ricinus communis29900.m00155029705.m000575
Sorghum bicolorSb08g003060.1
Thellungiella halophilaThhalv10013536mThhalv10013535mThhalv10028656mThhalv10013471m
Vitis viniferaGSVIVT01014265001GSVIVT01014272001GSVIVT01014269001GSVIVT01014271001GSVIVT01014270001
GSVIVT01014267001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)